Recombinant Human Protein CLN8(CLN8)

Code CSB-CF866210HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9UBY8
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLNATYRSLVARE KVFWDLAATRAVFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVA VHLSNLIFRTFDLFLVIHHLFAFLGFLGCLVNLQAGHYLAMTTLLLEMSTPFTCVSWMLL KAGWSESLFWKLNQWLMIHMFHCRMVLTYHMWWVCFWHWDGLVSSLYLPHLTLFLVGLAL LTLIINPYWTHKKTQQLLNPVDWNFAQPEAKSRPEGNGQLLRKKRP
Source in vitro E.coli expression system
Gene Names CLN8
Protein Names Recommended name: Protein CLN8
Expression Region 1-286
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Could play a role in cell proliferation during neuronal differentiation and in protection against cell death.
Involvement in disease Ceroid lipofuscinosis, neuronal, 8 (CLN8); Ceroid lipofuscinosis, neuronal, 8, Northern epilepsy variant (CLN8NE)
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein, Endoplasmic reticulum-Golgi intermediate compartment membrane, Multi-pass membrane protein, Endoplasmic reticulum
Database Links

HGNC: 2079

OMIM: 600143

KEGG: hsa:2055

STRING: 9606.ENSP00000328182

UniGene: Hs.127675

Related Products

CLN8 Antibodies

CLN8 Antibodies for Homo sapiens (Human)

CLN8 Proteins

CLN8 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.