Recombinant Human Proteinase-activated receptor 4 (F2RL3)

Code CSB-CF842751HU
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
F2RL3
Uniprot No.
Alternative Names
F2RL3; PAR4; Proteinase-activated receptor 4; PAR-4; Coagulation factor II receptor-like 3; Thrombin receptor-like 3
Species
Homo sapiens (Human)
Expression Region
48-385
Target Protein Sequence
GYPGQVCANDSDTLELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAP RLPSTMLLMNLAAADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLL AAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVL CHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAV VLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEF RDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for activated thrombin or trypsin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation.
Gene References into Functions
  1. Data suggested that PAR4-AP-induced platelet reactivity between PAR4 rs773902 was associated with altered intensity of Ca(2+) mobilization and ERK activation. PMID: 29289806
  2. Thrombin binding to extra-cellular loop II (ECLII) of PAR4 is important for its cleavage and activation of PAR4. PMID: 28448853
  3. PAR4 has a role in mediating platelet aggregation; its blockade provides antithrombotic activity PMID: 28053157
  4. PAR4 is required for platelet procoagulant function during thrombus formation in human blood PMID: 26878340
  5. Prospective study demonstrated that AHRR and F2RL3 methylation levels had inverse relationships with self-reported smoking status and accurately discriminated for both current- and former- smoking. Moreover, methylation markers distinguished former smokers from never-smokers with high accuracy and significantly associated with an increased risk of lung cancer. PMID: 28453567
  6. F2RL3 variants have the potential to markedly alter platelet PAR4 reactivity particularly after exposure to therapeutic PAR1 antagonists. PMID: 26966273
  7. these findings are the first to show that internalization of activated PAR4 is linked to proper ERK1/2 and Akt activation. PMID: 27402844
  8. an intracellular PAR4 C-terminal motif that regulates calcium signaling and beta-arrestin interactions, was identified. PMID: 28126849
  9. the contribution of PAR1 and PAR4 to thrombin-mediated activation of the platelet fibrin receptor (GPIIbIIIa), is reported. PMID: 27784794
  10. Suppression of PAR4 expression has no significant effect on the proliferation of SW620 cells, but can inhibit the migration of the cells. PMID: 27126938
  11. Both GPIbalpha and PAR4 are required for thrombin-induced reactive oxygen species formation in human platelets. PMID: 26569550
  12. Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling at least partly through CXCR4 to result in abdominal hypersensitivity without overt bladder inflammation PMID: 26020638
  13. protease-activated receptor 4 and Trefoil factor 2 are expressed in human colorectal cancer PMID: 25876034
  14. The PAR4 expression and activation via intracellular signaling pathways and the role of PAR4 signaling pathways in the development and maintenance of pain. PMID: 25664811
  15. This review summarizes the roles of PAR4 in coagulation and other extracellular protease pathways. PMID: 25120239
  16. Findings suggested that F2RL3 methylation is a very strong predictor of lung cancer risk and mortality, particularly at older age. PMID: 25821117
  17. Lower F2RL3 methylation is a strong predictor of mortality, including all-cause, cardiovascular, cancer and other mortality. Systemic adverse effects of smoking may be mediated by pathways associated with F2RL3 methylation. PMID: 24510982
  18. exosite II is critical for activation of PAR4. PMID: 24990072
  19. provide evidence against the hypothesis that PAR-1 and PAR-4 stimulation of platelets trigger differential release of alpha-granules PMID: 24776597
  20. Washed platelets from black volunteers were hyperaggregable in response to PAR4-mediated platelet stimulation compared with whites. PMID: 25278289
  21. PAR-4 appears to play a hitherto unsuspected role in diabetic vasculopathy. PMID: 25239438
  22. Quantitative trait locus analysis identified 3 common single nucleotide polymorphisms in the PAR4 gene (F2RL3) associated with PAR4-induced platelet aggregation. Thr120 was more common in blacks than whites. PMID: 25293779
  23. PAR4-P2Y12 association supports arrestin-mediated sustained signaling to Akt. PMID: 24723492
  24. PAR4 and GPVI-mediated platelet reactivity involves 12-lipoxygenase PMID: 23784669
  25. Phosphatidylcholine transfer protein contributes to the racial difference in PAR4-mediated platelet activation. PMID: 24216752
  26. The F2RL3 rs773857 risk allele homozygotes are associated with risk for increased platelet count and hyperactivity. PMID: 22228373
  27. Stimulation of PAR4 on platelets leads to faster and more robust thrombin generation, compared to PAR-1 stimulation. PMID: 23307185
  28. The results seem to indicate methylation in F2RL3 to be a potential mediator of the detrimental impact of smoking and mortality in coronary heart disease PMID: 22511653
  29. PAR4 is down-regulated in the colonic mast cells of post-infectious irritable bowel syndrome. PMID: 22151913
  30. Novel role for proteinase-activated receptor 2 (PAR2) in membrane trafficking of proteinase-activated receptor 4 (PAR4). PMID: 22411985
  31. mutations that disrupted dimer formation had reduced calcium mobilization in response to the PAR4 agonist peptide. PMID: 22318735
  32. PKC inhibition markedly enhances Ca2+ signaling and phosphatidylserine exposure downstream of protease-activated receptor-1 but not protease-activated receptor-4 in human platelets. PMID: 21649850
  33. down-regulation of PAR4 expression occurs frequently in gastric cancers and exhibits association with more aggressive gastric cancer PMID: 21635966
  34. The present study elucidates further differences in human platelet PAR signalling regulation and provides evidence for a cross-talk in which PAR4 signalling counteracts mechanisms involved in PAR1 signalling down-regulation. PMID: 21391917
  35. High glucose enhances smooth muscle cell responsiveness to thrombin through transcriptional upregulation of PAR-4, mediated via PKC and NFkappaB. PMID: 21164077
  36. Protease-activated receptor signaling in platelets activates cytosolic phospholipase A2alpha differently for cyclooxygenase-1 and 12-lipoxygenase catalysis. PMID: 21127289
  37. Results suggest that lower levels of protease-activated receptors 1 and 4 contribute to the poor thrombin induced aggregation observed with newborn platelets, which can not be compensated by higher levels of GPIbalpha. PMID: 20807173
  38. Low concentrations of alpha-thrombin accelerate tissue factor-induced thrombin generation on the surface of vascular smooth muscle cells, and this effect is mediated by PAR-3 and PAR-4. PMID: 20930172
  39. Human cytomegalovirus induces PARs expression through transcriptional activation in endothelial cells, increasing sensitivity to thrombin. PMID: 20155436
  40. SPSB1 and SPSB4 bind strongly to both Par-4 and VASA peptides. PMID: 20561531
  41. Data show that PAR1 and PAR4-activating peptides were as effective as thrombin in inducing annexin V binding in combination with collagen-related peptide in diluted whole blood and platelet rich plasma, but not in washed platelets. PMID: 20230207
  42. Thrombin enhances the migration of chondrosarcoma cells by increasing MMP-2 and MMP-13 expression through the PAR/PLC/PKCalpha/c-Src/NF-kappaB signal transduction pathway. PMID: 20175118
  43. Complement protease MASP-1 activates human endothelial cells through PAR4 cleavage PMID: 19667088
  44. When expressed in respiratory epithelial cells and cell lines, protease-activated receptor 4 (PAR4)induces the release of IL-6, IL-8, and PGE2. PMID: 11907122
  45. Activation of platelets via the PAR4 pathway, by treatment with PAR4 agonist peptide AYPGKF, results in thrombin-induced thromboxane production by platelets. PMID: 12006403
  46. The signal from PAR4 stabilizes platelet-platelet aggregate formation in the absence of P2Y12 activation by ADP. PMID: 12008957
  47. PAR4 is activated independently of GPIbalpha and ADP PMID: 12871418
  48. Important role in regulation of thromboxane formation in platelets responding to thrombin through prolonged elevation of [Ca(2+)](i) and activation of phospholipase A(2). Can be activated by relatively low concentrations of thrombin in human platelets. PMID: 12888878
  49. Protease-activated receptor-4 exodomains utilize dual prolines and an anionic retention motif for thrombin recognition and cleavage. PMID: 13678420
  50. PAR-1 and PAR-4 have roles in activating GPIb translocation into the cytoskeleton in platelets PMID: 14521606

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed, with highest levels in lung, pancreas, thyroid, testis and small intestine. Not expressed in brain, kidney, spinal cord and peripheral blood leukocytes. Also detected in platelets.
Database Links

HGNC: 3540

OMIM: 602779

KEGG: hsa:9002

STRING: 9606.ENSP00000248076

UniGene: Hs.137574

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X