Recombinant Human RPE-retinal G protein-coupled receptor(RGR)

Code CSB-CF019640HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P47804
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLAL ADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTR SQLAWNSAVSLVLFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTM SFFNFAMPLFITITSYSLMEQKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVIADVT SISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK
Source in vitro E.coli expression system
Gene Names RGR
Protein Names Recommended name: RPE-retinal G protein-coupled receptor
Expression Region 1-291
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for all-trans- and 11-cis-retinal. Binds preferentially to the former and may catalyze the isomerization of the chromophore by a retinochrome-like mechanism.
Involvement in disease Retinitis pigmentosa 44 (RP44)
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Preferentially expressed at high levels in the retinal pigment epithelium (RPE) and Mueller cells of the neural retina.
Database Links

HGNC: 9990

OMIM: 600342

KEGG: hsa:5995

STRING: 9606.ENSP00000352427

UniGene: Hs.1544

Related Products

RGR Antibodies

RGR Antibodies for Homo sapiens (Human)

RGR Antibodies for Human

RGR Proteins

RGR Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.