Recombinant Human Radiation-inducible immediate-early gene IEX-1 (IER3)

Code CSB-CF011002HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
IER3; DIF2; IEX1; PRG1; Radiation-inducible immediate-early gene IEX-1; Differentiation-dependent gene 2 protein; Protein DIF-2; Immediate early protein GLY96; Immediate early response 3 protein; PACAP-responsive gene 1 protein; Protein PRG1
Species
Homo sapiens (Human)
Expression Region
1-156
Target Protein Sequence
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment.
Gene References into Functions
  1. Our findings suggest for the first time that the increased expression of IER3 protein may promote the aggressive progression of BCa. Importantly, IER3 may be a potential prognostic marker for BCa patients. PMID: 30249226
  2. we determined the molecular mechanism responsible for IER3 degradation, involving a ternary complex of IER3, MDM2 and FHL2, which may contribute to cervical tumor growth. Furthermore, we demonstrated that FHL2 serves as a scaffold for E3 ligase and its substrate during the ubiquitination reaction, a function that has not been previously reported for this protein PMID: 26973248
  3. Analysis of consensus EGR-binding elements (EBEs) showed that the immediate early response 3 gene (IER3) is a novel transcriptional target gene of EGR2 as confirmed by the luciferase assay, electrophoretic mobility-shift assay (EMSA), chromatin immunoprecipitation (ChIP), and western blot analysis. PMID: 27890615
  4. Study characterized IEX-1's expression and function in rheumatoid arthritis synovial fibroblasts and showed that IEX-1 is highly expressed in RA-SFs and negatively regulates RA-SF activation. PMID: 27736946
  5. interleukin-1beta (IL-1beta)-induced IER3 expression is mediated by the ERK1/2 target, transcription factor Elk-1. PMID: 25066273
  6. findings suggest that IER3 is a putative tumor suppressor in the cervix, and the c-Ab1/p73beta/IER3 axis is a novel and crucial signaling pathway that confers etoposide chemosensitivity. PMID: 25666857
  7. High expression of IER3 is associated with hepatocarcinoma. PMID: 25684507
  8. In human samples removed from failed AVF, there was a significant increase in IEX-1 expression localized to the adventitia. PMID: 25036043
  9. IEX-1 expression levels correlate with the severity of preeclampsia PMID: 23725081
  10. Studied the binding effect of hcmv-miR-UL148D to the 3' untranslated region (3'UTR) of IEX-1.Results showed that only one binding site in the 3'UTR of IEX-1 was completely complementary to an 11nt sequence in the 5' terminus of hcmv-mir-UL148D. PMID: 23403649
  11. the interference of IER3 with the PI3K/Akt-Fyn pathway represents a novel mechanism of Nrf2 regulation that may get lost in tumors and by which IER3 exerts its stress-adaptive and tumor-suppressive activity. PMID: 24311782
  12. IEX-1 plays a role in suppression of apoptosis and protects cells by controlling sensitivity to TNFalpha under both normal and inflammatory conditions. PMID: 21250941
  13. Altered IEX-1 expression can potentially be a new predictor of the malignant transformation and a prognostic indicator for cancer therapy. PMID: 22085302
  14. Changes of methylation status of gene IEX-1 promoter CpG island correlates with hematologic malignancies. PMID: 21518511
  15. IER3 plays a complex and to some extent contradictory role in cell cycle control and apoptosis. Effects of IER3 relate to an interference with certain signalling pathways PMID: 21112119
  16. IER3 is upregulated in human PDLCs subjected to tensile stress related to mechano-induced cell cycle arrest. PMID: 20934684
  17. Results suggest that hypertension in IEX-1 knockout mice may arise primarily from impaired cAMP signaling induced by overproduction of mitochondrial reactive oxygen species in vascular smooth muscle cells. PMID: 20713914
  18. Impaired apoptosis, extended duration of immune responses, and a lupus-like autoimmune disease in IEX-1-transgenic mice. PMID: 11782530
  19. regulation by p53 tumor suppressor and Sp1 PMID: 11844788
  20. mechanical strain increased IEX-1 gene expression in macrophages PMID: 11910304
  21. Characterization of a novel hexameric repeat DNA sequence in the promoter of the immediate early gene, IEX-1, that mediates 1alpha,25-dihydroxyvitamin D(3)-associated IEX-1 gene repression. PMID: 12032839
  22. IEX-1 is a new type of ERK substrate that has a dual role in ERK signaling by acting both as an ERK downstream effector mediating survival and as a regulator of ERK activation PMID: 12356731
  23. IEX-1 has roles in regulation of cell death and oncogenesis [review] PMID: 12510147
  24. Overexpression of IEX-1S results in acceleration of TNF-alpha-induced hepatocyte apoptosis through blockade of the PI3K/Akt survival pathway. PMID: 12682234
  25. failure of IEX-1 to express its protein reflects the numerous mechanisms by which HSV-1 thwarts the cells from expressing its genes after infection PMID: 12743274
  26. IEX-1 attenuates NF-kappaB activation, a possible counter-regulatory process leading to apoptosis. PMID: 12761504
  27. IEX-1 expression was stimulated by hydroxytamoxifen, that the degree of increase was greater in resistant cells (four-fold versus 1.5-fold) and that this hydroxytamoxifen regulation was estrogen receptor dependent PMID: 15120418
  28. Our data suggest that IEX-1 may regulate apoptosis by directly interacting with various proteins involved in the control of apoptotic pathways. PMID: 15451437
  29. concluded that IEX-1 mRNA is not preferentially degraded during HSV-1 infection and that HSV-1 instead inhibits the normal turnover of this mRNA PMID: 15767410
  30. We found that p73beta targets the apoptotic program at multiple levels: facilitating caspase activation through p53-dependent signals and inducing p57KIP2, while down-regulating c-IPA1 and IEX1 through a p53-independent mechanism. PMID: 15781630
  31. IEX-1 is organized in subnuclear structures and partially co-localizes with promyelocytic leukemia protein in HeLa cells PMID: 15855159
  32. sequence-targeting mutagenesis reveals a transmembrane-like integrated region of the protein that is critical for both pro-apoptotic and anti-apoptotic functions PMID: 16567805
  33. IEX-1 plays an important role in astrocytic differentiation of human glioma cells and that IEX-1 functions at downstream of PKA. PMID: 16960879
  34. ICP27 is essential for IEX-1 mRNA stabilization whereas virion host shut plays little if any role PMID: 16973576
  35. Modulates NF-kappaB-dependent antiapoptotic protection and thereby exerts tumor-suppressive potential. PMID: 17704804
  36. This study indicates that an evaulation of IEX-1 expression may be clinically useful for predicting patient prognosis in pancreatic cancer. PMID: 18026799
  37. study showed that IEX-1 is involved in the radiation-induced apoptosis of human glioma cells and that its overexpression enhances the apoptotic sensitivity of these cells to gamma-radiation PMID: 18564103
  38. down-regulation of IEX-1 gene was associated with short survival in myelodysplastic syndrome patients PMID: 19152102
  39. This study demonstrated the physical association of the MCL-1 and IEX-1 proteins, the modulatory role of MCL-1 in IEX-1-induced apoptosis, and the role of BIM as an essential downstream molecule for IEX-1-induced cell death. PMID: 19285955
  40. The small interfering RNA knockdown of BNIP3, IER3, and SEPW1 genes affected critical multiple myeloma endothelial cell functions correlated with the overangiogenic phenotype PMID: 19690192
  41. Results suggest dysregulated expression of IER3 is common in MDS (61% >4-fold increase or decrease in expression with decreased expression primarily in early MDS and increased expression primarily in later MDS progressing toward leukemia). PMID: 19773435

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
IER3 family
Database Links

HGNC: 5392

OMIM: 602996

KEGG: hsa:8870

STRING: 9606.ENSP00000259874

UniGene: Hs.730861

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1