Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF875715HU |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q9HBX9 |
| Storage Buffer | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Species | Homo sapiens (Human) |
| Sequence | MTSGSVFFYILIFGKYFSHGGGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETNLRA VPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKITSISIYAFRGLNSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPPTFYGLNSLILLVLMNNVLTRLPDK PLCQHMPRLHWLDLEGNHIHNLRNLTFISCSNLTVLVMRKNKINHLNENTFAPLQKLDEL DLGSNKIENLPPLIFKDLKELSQLNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQ RMFRPLMNLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTC FGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKFRGEYNKHAQLWM ESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGF IVAFIPLSNKEFFKNYYGTNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYG SMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVKFLSLLQVEIPGT ITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWV EMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS |
| Source | in vitro E.coli expression system |
| Gene Names | RXFP1 |
| Protein Names | Recommended name: Relaxin receptor 1 Alternative name(s): Leucine-rich repeat-containing G-protein coupled receptor 7 Relaxin family peptide receptor 1 |
| Expression Region | 1-757 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP. |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen. |
| Database Links |
HGNC: 19718 OMIM: 606654 KEGG: hsa:59350 STRING: 9606.ENSP00000303248 UniGene: Hs.591686 |
RXFP1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA875715LD01HU | RXFP1 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA875715LC01HU | RXFP1 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA875715LB01HU | RXFP1 Antibody, HRP conjugated | Human | ELISA |
RXFP1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA875715LA01HU | RXFP1 Antibody | Human | ELISA, IF |
RXFP1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP875715HU1 CSB-EP875715HU1 CSB-BP875715HU1 CSB-MP875715HU1 |
Recombinant Human Relaxin receptor 1(RXFP1),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Mouse L-dopachrome tautomerase(Dct),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Heterogeneous nuclear ribonucleoprotein L(HNRNPL),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human G2/mitotic-specific cyclin-B1(CCNB1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Guanine nucleotide-binding protein subunit alpha-15(GNA15)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cellular tumor antigen p53(TP53)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Glycine max Gamma-glutamyl hydrolase
Express system: E.coli
Species: Glycine max (Soybean) (Glycine hispida)
