Recombinant Human Rhomboid domain-containing protein 2(RHBDD2)

Code CSB-CF743985HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6NTF9
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAASGPGCRSWCLCPEVPSATFFTALLSLLVSGPRLFLLQQPLAPSGLTLKSEALRNWQV YRLVTYIFVYENPISLLCGAIIIWRFAGNFERTVGTVRHCFFTVIFAIFSAIIFLSFEAV SSLSKLGEVEDARGFTPVAFAMLGVTTVRSRMRRALVFGMVVPSVLVPWLLLGASWLIPQ TSFLSNVCGLSIGLAYGLTYCYSIDLSERVALKLDQTFPFSLMRRISVFKYVSGSSAERR AAQSRKLNPVPGSYPTQSCHPHLSPSHPVSQTQHASGQKLASWPSCTPGHMPTLPPYQPA SGLCYVQNHFGPNPTSSSVYPASAGTSLGIQPPTPVNSPGTVYSGALGTPGAAGSKESSR VPMP
Source in vitro E.coli expression system
Gene Names RHBDD2
Protein Names Recommended name: Rhomboid domain-containing protein 2
Expression Region 1-364
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Golgi apparatus, cis-Golgi network membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Database Links

HGNC: 23082

OMIM: 615203

KEGG: hsa:57414

STRING: 9606.ENSP00000006777

UniGene: Hs.488827

Related Products

RHBDD2 Proteins

RHBDD2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.