Recombinant Human Rhomboid-related protein 3(RHBDL3)

Code CSB-CF019673HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P58872
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFDQFDPGNTGYISTGKFR SLLESHSSKLDPHKREVLLALADSHADGQIGYQDFVSLMSNKRSNSFRQAILQGNRRLSS KALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITVTLLEVAFFLYN GVSLGQFVLQVTHPRYLKNSLVYHPQLRAQVWRYLTYIFMHAGIEHLGLNVVLQLLVGVP LEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMK CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRN YEQRLQDQSLWWIFVAMYTVFVLFAVFWNIFAYTLLDLKLPPPP
Source in vitro E.coli expression system
Gene Names RHBDL3
Protein Names Recommended name: Rhomboid-related protein 3 EC= 3.4.21.105 Alternative name(s): Ventrhoid transmembrane protein
Expression Region 1-404
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Peptidase S54 family
Database Links

HGNC: 16502

KEGG: hsa:162494

STRING: 9606.ENSP00000269051

UniGene: Hs.655027

Related Products

RHBDL3 Proteins

RHBDL3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.