Recombinant Severe acute respiratory syndrome coronavirus Envelope small membrane protein (E)

Code CSB-CF348676HQE
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
E
Uniprot No.
Alternative Names
E; sM; 4; Envelope small membrane protein; E protein; sM protein
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Expression Region
1-76
Target Protein Sequence
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis. Activates the host NLRP3 inflammasome, leading to IL-1beta overproduction.
Gene References into Functions
  1. A structural model of a SARS-CoV E construct in LMPG micelles shows unequivocal intermolecular nuclear Overhauser effects. The C-terminal domain is mostly alpha-helical, and extramembrane intermolecular NOEs suggest interactions that may affect the TM channel conformation. PMID: 29474890
  2. distinct oligomeric forms of IBV E, one essential for assembly and the other with a role in disruption of the secretory pathway. PMID: 26136577
  3. Data show that the E protein has only one transmembrane (TM) domain in micelles, whereas the predicted beta-coil-beta motif forms a short membrane-bound alpha-helix connected by a disordered loop to the TM domain. PMID: 24668816
  4. These results suggested that the lipids are functionally involved in E protein ion channel activity, forming a protein-lipid pore. PMID: 22832120
  5. We showed that the SARS-CoV E protein is targeted to the Golgi region in HeLa cells and colocalizes most closely with GM130, which is a cis-Golgi protein. PMID: 21450821
  6. Data suggest that hijacking of PALS1 by SARS-CoV E plays a determinant role in the disruption of the lung epithelium in SARS patients. PMID: 20861307
  7. results show that the envelope (E) protein of severe acute respiratory syndrome-associated coronavirus can induce membrane permeability changes when expressed in Escherichia coli PMID: 15522242
  8. The E protein is not glycosylated. PMID: 15831954
  9. A novel molecular mechanism of T-cell apoptosis that contributes to the SARS-CoV-induced lymphopenia observed in most SARS patients is reported. PMID: 16048439
  10. expression of the SARS-CoV E protein in mammalian cells alters the membrane permeability of these cells; Systematic mutagenesis studies confirm that the membrane permeabilizing activity of the E protein is associated with its transmembrane domain PMID: 16507314
  11. The N- and C-termini of the SARS-CoV E protein are exposed to the cytoplasmic side of the membranes (N(cyto)C(cyto)). PMID: 16684538
  12. the expression of the structural protein, envelope (E), was down-regulated by 8b but not 8a or 8ab. PMID: 16876844
  13. analysis of the viroporin activity of SARS-CoV E protein PMID: 17037530
  14. conformational flexibility required during ion channel function PMID: 18658207
  15. both E and N proteins must be coexpressed with M protein for the efficient production and release of virus-like particles by transfected Vero E6 cells. PMID: 18753196
  16. Both the transmembrane domains of E protein are required to interact with M protein, while either of the hydrophilic regions (a.a. 1-10 or 60-76) is dispensable as shown by co-immunoprecipitation assay. PMID: 19322648

Show More

Hide All

Subcellular Location
Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus membrane; Single-pass type III membrane protein.
Protein Families
Betacoronaviruses E protein family
Database Links

KEGG: vg:1489671

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1