Product Details

Target Names

Uniprot No.

P59637

Alternative Names

E; sM; 4; Envelope small membrane protein; E protein; sM protein

Species

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Expression Region

1-76

Target Protein Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis. Activates the host NLRP3 inflammasome, leading to IL-1beta overproduction.

Gene References into Functions

A structural model of a SARS-CoV E construct in LMPG micelles shows unequivocal intermolecular nuclear Overhauser effects. The C-terminal domain is mostly alpha-helical, and extramembrane intermolecular NOEs suggest interactions that may affect the TM channel conformation. PMID: 29474890
distinct oligomeric forms of IBV E, one essential for assembly and the other with a role in disruption of the secretory pathway. PMID: 26136577
Data show that the E protein has only one transmembrane (TM) domain in micelles, whereas the predicted beta-coil-beta motif forms a short membrane-bound alpha-helix connected by a disordered loop to the TM domain. PMID: 24668816
These results suggested that the lipids are functionally involved in E protein ion channel activity, forming a protein-lipid pore. PMID: 22832120
We showed that the SARS-CoV E protein is targeted to the Golgi region in HeLa cells and colocalizes most closely with GM130, which is a cis-Golgi protein. PMID: 21450821
Data suggest that hijacking of PALS1 by SARS-CoV E plays a determinant role in the disruption of the lung epithelium in SARS patients. PMID: 20861307
results show that the envelope (E) protein of severe acute respiratory syndrome-associated coronavirus can induce membrane permeability changes when expressed in Escherichia coli PMID: 15522242
The E protein is not glycosylated. PMID: 15831954
A novel molecular mechanism of T-cell apoptosis that contributes to the SARS-CoV-induced lymphopenia observed in most SARS patients is reported. PMID: 16048439
expression of the SARS-CoV E protein in mammalian cells alters the membrane permeability of these cells; Systematic mutagenesis studies confirm that the membrane permeabilizing activity of the E protein is associated with its transmembrane domain PMID: 16507314
The N- and C-termini of the SARS-CoV E protein are exposed to the cytoplasmic side of the membranes (N(cyto)C(cyto)). PMID: 16684538
the expression of the structural protein, envelope (E), was down-regulated by 8b but not 8a or 8ab. PMID: 16876844
analysis of the viroporin activity of SARS-CoV E protein PMID: 17037530
conformational flexibility required during ion channel function PMID: 18658207
both E and N proteins must be coexpressed with M protein for the efficient production and release of virus-like particles by transfected Vero E6 cells. PMID: 18753196
Both the transmembrane domains of E protein are required to interact with M protein, while either of the hydrophilic regions (a.a. 1-10 or 60-76) is dispensable as shown by co-immunoprecipitation assay. PMID: 19322648

Hide All

Subcellular Location

Host endoplasmic reticulum-Golgi intermediate compartment. Host Golgi apparatus membrane; Single-pass type III membrane protein.

Protein Families

Betacoronaviruses E protein family

Database Links

KEGG: vg:1489671

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：

Code	CSB-CF348676HQE
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Severe acute respiratory syndrome coronavirus Envelope small membrane protein (E)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage