Recombinant Human SARS coronavirus Membrane protein(M)

Code CSB-CF348664HQE
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names M
Uniprot No. P59596
Alternative Names M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Species Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Expression Region 1-221
Target Protein Sequence MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRFLYIIKLVFLWLLWPVT LACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLFARTRSMWSFNPETNILLN VPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHSLGRCDIKDLPKEITVATSRTLSYYKL GASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIALLVQ
Protein Length full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.
Gene References into Functions
  1. Specific amino acids are critical for M protein function in terms of directing virus assembly. PMID: 23700447
  2. Like S, M acquires high-mannose N-glycans that are subsequently modified into complex N-glycans in the Golgi. PMID: 15831954
  3. This is the first report describing the induction of apoptosis by SARS-CoV M protein in animal cells and possible implications are discussed. PMID: 16797548
  4. The results show that M and N proteins of SARS-CoV can induce apoptosis of human pulmonary fibroblast cells. PMID: 16845612
  5. The crystal structure of M(pro) at a resolution of 1.82 Angstroms, in space group P2(1) at pH 6.0, is reported. PMID: 17196984
  6. cytoplasmic C-terminus domain of SARS-CoV M protein was responsible for binding to NC protein PMID: 18792806
  7. the expression of M protein prevents the formation of TRAF3.TANK.TBK1/IKKepsilon complex and thereby inhibits TBK1/IKKepsilon-dependent activation of IRF3/IRF7 transcription factors PMID: 19380580

Show More

Hide All

Subcellular Location Virion membrane, Multi-pass membrane protein, Host Golgi apparatus membrane, Multi-pass membrane protein
Protein Families Betacoronaviruses M protein family
Database Links

KEGG: vg:1489672

  Tel: 301-363-4651
  Email: [email protected]
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1