Recombinant Human Seipin (BSCL2)

Code CSB-CF842676HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
BSCL2
Uniprot No.
Alternative Names
BSCL2; Seipin; Bernardinelli-Seip congenital lipodystrophy type 2 protein
Species
Homo sapiens (Human)
Expression Region
1-398
Target Protein Sequence
MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTV SHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVN QDLGMFLVTISCYTRGGRIISTSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLE VELYADYRENSYVPTTGAIIEIHSKRIQLYGAYLRIHAHFTGLRYLLYNFPMTCAFIGVA SNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEE STPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWEDAALLTE ANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a crucial role in the formation of lipid droplets (LDs) which are storage organelles at the center of lipid and energy homeostasis. In association with LDAF1, defines the sites of LD formation in the ER. Also required for growth and maturation of small nascent LDs into larger mature LDs. Mediates the formation and/or stabilization of endoplasmic reticulum-lipid droplets (ER-LD) contacts, facilitating protein and lipid delivery from the ER into growing LDs. Regulates the maturation of ZFYVE1-positive nascent LDs and the function of the RAB18-ZFYVE1 complex in mediating the formation of ER-LD contacts. Binds anionic phospholipids including phosphatidic acid. Plays an important role in the differentiation and development of adipocytes.
Gene References into Functions
  1. SH3TC2, PMP2, and BSCL2 pathogenic variants might be rare in Chinese Charcot-Marie-Tooth (CMT) patients. PMID: 29336362
  2. In this Chinese Han population the novel Charcot-Marie-Tooth disease-associated gene mutations BSCL2 was discovered. PMID: 27862672
  3. Mutation in BSCL2 gene is associated with Type 2 congenital generalized lipodystrophy. PMID: 28916377
  4. These data identify SEIPIN as an evolutionarily conserved regulator of microsomal GPAT. PMID: 27806294
  5. We identified a novel BSCL2 mutation, c.213-1336_c.294 + 1921delinsCA, which is expected to result in p.Thr72Cysfs*2, among classical Berardinelli-Seip syndrome patients in northern Peru. This null mutation was shared by five patients from two pedigrees, indicating the presence of a founder mutation. PMID: 27868354
  6. Results provide evidence that the hepatic BSCL2 deficiency induces the increase and expansion of lipid droplets potentially via increased SCD1 activity. PMID: 27838812
  7. results suggest that Celia seipin is probably playing an underestimated role in adipocyte maturation, but not in senescence, and its expression can be modified by exogenous factors as fatty acids. PMID: 27391332
  8. Data show that all three patients exhibited characteristic features of congenital generalized lipodystrophy (CGL) due to mutations in the Bernardinelli-Seip congenital (BSCL2) gene. PMID: 27612026
  9. Together, these data suggest that seipin helps to connect newly formed lipid droplets to the endoplasmic reticulum and that by stabilizing endoplasmic reticulum-lipid droplet contacts seipin facilitates the incorporation of protein and lipid cargo into growing lipid droplets in human cells. PMID: 27879284
  10. Increased aggregation and subsequent impaired oligomerization of Celia seipin leads to cell death. In heterozygous carriers, wildtype seipin might prevent the damage caused by mutant seipin through its sequestration into harmless mixed oligomers. PMID: 26282322
  11. BSCL2 defines the localization of adipose differentiation-related protein, which has a role in lipid accumulation and adipogenic differentiation PMID: 26975546
  12. BSCL2 mutations account for a small number of patients with inherited neuropathies in Taiwan. The p.R96H mutation is associated with distal hereditary motor neuropathy. PMID: 26815532
  13. We confirmed reduction of brain volume and number of sperm in human patients with BSCL2 mutation. This is the first report demonstrating that seipin is necessary for normal brain development and spermatogenesis PMID: 25934999
  14. The S90L mutationof BSCL2 is predominantly associated with Silver syndrome PMID: 25487175
  15. The mutation of seipin at glycosylation sites disrupt its function in regulating lipid droplet metabolism, and the autophagy acts as an adaptive response to break down abnormal lipid droplets. PMID: 25832430
  16. a brief overview of the genetic association of the CGLs, and focus on the current understanding of differential contributions of distinct seipin domains to lipid storage and adipogenesis. PMID: 25195639
  17. A missense mutation was found in BSCL2 N88S, in a patient with Silver syndrome. PMID: 25219579
  18. A homozygous and truncating mutation was identified in the BSCL2 gene suggesting congenital generalized lipodystrophy. PMID: 24961962
  19. Here, we report teratozoospermia syndrome in a lipodystrophic patient with compound BSCL2 mutations, with sperm defects resembling the defects of infertile seipin null mutant mice. PMID: 24778225
  20. This study presents potential molecular mechanisms by which different pathogenic mutations in the human lipodystrophy protein seipin may cause severe lipodystrophy. PMID: 23989774
  21. Our results suggest that exon 7 skipping in the BSCL2 gene due to the c.985C>T mutation is responsible for a novel early onset, fatal neurodegenerative syndrome involving cerebral cortex and basal ganglia. PMID: 23564749
  22. Mutation identified in BSCL2 gene causing congenital generalized lipodystrophy Pakistani population. PMID: 23659685
  23. This study analysed the relationship between hepacivirus (HCV) and seipin, a protein involved in lipid droplet maturation, and suggested that the outer surface of lipid droplets is a critical factor for HCV release. PMID: 23907395
  24. This study showed that a A novel polymorphism G-->T was found in the Berardinelli-Seip congenital lipodystrophy 2 gene on intron 4 in patient with hereditary motor neuropathy type V in Italy family. PMID: 22427291
  25. Identification of a known BSCL2 mutation in a family with Charcot-Marie-Tooth disease. PMID: 23553728
  26. This report expands the variability of the clinical spectrum associated with the BSCL2 gene and describes the first family with the p.S90W mutation. PMID: 23142943
  27. The mutant seipin (Bscl2) formed protein aggregates in the CNS neurons of transgenic mice and caused a specific loss of alpha motor neurons in the ventral horn of spinal cord. PMID: 23470542
  28. role of seipin in human disease PMID: 22474068
  29. the increased expression of seipin markedly reduced the mass of white adipose tissue and the size of adipocytes and lipid droplets PMID: 22234369
  30. the biochemical characteristics of seipin and its mis-sense mutants PMID: 21957196
  31. N88S seipin mutant transgenic mice develop motor neuron disease via endoplasmic reticulum stress. PMID: 21750110
  32. Case Report: novel BSCL2 mutation in an Indian patient with congenital generalized lipodystrophy associated with normal intellectual ability. PMID: 18690553
  33. DNA sequencing of BSCL2 was performed and a heterozygous N88S missense mutation in BSCL2 gene was detected in all three patients with distal hereditary motor neuropathy type V PMID: 20598714
  34. study of an Italian family with a Charcot-Marie-Tooth disease type 2 phenotype with pyramidal signs; in the 3 affected siblings an S90L mutation was revealed; confirms variability of phenotypes associated with Ser90Leu mutation PMID: 20806400
  35. Japanese CGL patients with BSCL2 mutations presented with severe insulin resistance, even during infancy, prior to the development of diabetes mellitus PMID: 19438831
  36. This report suggests that a different type of distal hereditary motor neuropathy could exist within one family carrying N88S mutations in BSCL2. PMID: 19323790
  37. Heterozygous missense mutations in BSCL2 are associated with distal hereditary motor neuropathy and Silver syndrome. PMID: 14981520
  38. We identified a novel nonsense mutation of seipin at codon 275 (R275X). Of four congenital generalized lipodystrophy patients, three were homozygous for R275X. No seipin mutation was found in any exon in one patient. PMID: 15126564
  39. Our study indicates that the dominant N88S mutation in the Berardinelli-Seip congenital lipodystrophy gene 2 leads to a broad spectrum of motor neuron disorders. PMID: 15732094
  40. description of two Dutch families with BSCL2 mutations and phenotypic variability of the gene mutation. Features are compatible with Silver syndrome, variant Silver syndrome (foot rather than hand involvement), distal HMN type II, or distal HMN type V. PMID: 16427281
  41. This study reaffirms the clinical phenotype of the disorders associated with a BSCL2 Ser90Leu mutation and describes a genetically proven family with Silver syndrome and dHMN type V in Asia. PMID: 17486577
  42. The 669insA mutation in exon 4 of the BSCL2 gene was identified as the major genetic alteration leading to BSCL in a group of 22 patients from the northeastern Brazilian state of Rio Grande do Norte. PMID: 17535271
  43. Our data confirm that most likely only two mutations (N88S, S90L) in exon 3 of BSCL2 may lead to dHMN-V or SS phenotypes. PMID: 17663003
  44. seipin is found at endoplasmic reticulum lipid droplet junctions and is important for droplet morphology PMID: 18093937
  45. Silver syndrome--related to the N88S mutation in the BSCL2 gene--is characterized by a spectrum of clinical findings PMID: 18224579
  46. These results suggest that an evolutionally conserved function of seipin in phospholipid metabolism and LD formation may be functionally important in human adipogenesis. PMID: 18250201
  47. Study demonstrates that BSCL2 is an essential, cell-autonomous regulator of adipogenesis. PMID: 18458148
  48. The transmembrane domains in seipin are critical for ER retention, ubiquitination, formation of inclusions, and activation of UPR. Seipin expression is detected in neurons in the spinal cord and in the frontal lobe cortex of the brain. PMID: 18585921
  49. Here we report the third Italian family with dHMN and SPG17 in which two affected members harbor the heterozygous N88S mutation in the BSCL2 gene. PMID: 18612770
  50. A new subtype of congenital generalized lipodystrophy is not associated with the BSCL2 gene. PMID: 18698612

Show More

Hide All

Involvement in disease
Congenital generalized lipodystrophy 2 (CGL2); Spastic paraplegia 17, autosomal dominant (SPG17); Neuronopathy, distal hereditary motor, 5A (HMN5A); Encephalopathy, progressive, with or without lipodystrophy (PELD)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet.
Protein Families
Seipin family
Tissue Specificity
Expressed in motor neurons in the spinal cord and cortical neurons in the frontal lobe (at protein level). Highly expressed in brain, testis and adipose tissue.
Database Links

HGNC: 15832

OMIM: 269700

KEGG: hsa:26580

STRING: 9606.ENSP00000354032

UniGene: Hs.533709

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1