Recombinant Human Substance-K receptor (TACR2)

Code CSB-CF023069HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TACR2; NK2R; NKNAR; TAC2R; Substance-K receptor; SKR; NK-2 receptor; NK-2R; Neurokinin A receptor; Tachykinin receptor 2
Species
Homo sapiens (Human)
Expression Region
1-398
Target Protein Sequence
MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance K > neuromedin-K > substance P.
Gene References into Functions
  1. This study revealed for the first time an increase of Mast Cells -nerve association and NK2R expression on Mast Cells during Allergic Rhinitis as well as nerve fibres containing receptors for mass cells. PMID: 28030866
  2. Neuropeptide signaling through neurokinin-1 and neurokinin-2 receptors augments antigen presentation by human dendritic cells PMID: 26371842
  3. The occurrence of a profound alteration in NK receptor expression in RMDD is a novel finding that suggests NK-1R and NK-2R pathways as possible players in major depressive disorder. PMID: 23142211
  4. NK2R-dependent neuropeptide signaling regulates Ag-specific T cell responses via activation of DC function PMID: 22474018
  5. This study demonistrated that no association of Tachykinin receptor 2 (TACR2) polymorphisms with Alzheimer's disease. PMID: 19375820
  6. Tachykinin NK2 receptors mediate smooth muscle contraction in human corpus cavernosum and spongiosum. PMID: 11906947
  7. Identification of a tachykinin NK(2) receptor splice variant. PMID: 12427486
  8. protease-activated receptor 2 agonists induced a contraction of murine intestinal smooth muscle that was mediated by nerves and requires both neurokinin 1 and 2 receptors PMID: 12801882
  9. NK2 receptors are compartmentalized at the plasma membrane PMID: 15294896
  10. We propose that the N-terminus of NKA is exposed and accessible to the extracellular medium. Subsequent amino acids of the NKA peptide become progressively more buried residues up to approximately one-third of the transmembrane-spanning domain. PMID: 17402972
  11. Data indicate that presynaptic and postsynaptic neuroneuronal and neuromuscular regulatory processes mediated by tachykinins via NK2r may occur for modulating human colonic motility. PMID: 17503489
  12. Increased proportion of alveolar macrophages expressing neurokinin 2 receptor may be involved in the pathogenesis of COPD. PMID: 17532769
  13. all three subtypes of NKRs are expressed in native human airway smooth muscle cells & IP3 levels are the primary mediators of NKR-stimulated initial [Ca2+]i increases, whereas store-operated Ca2+ channels mediate sustained phase of the [Ca2+]i increase. PMID: 18203813
  14. NK2 receptors are involved in the neuroneuronal and neuromuscular processes regulating human colonic motility. PMID: 18219665
  15. polymorphisms leading to the Ile23Thr and Arg375His amino acid exchanges are highly prevalent in the human TACR2 gene, but do affect the potency of the endogenous agonist NKA or small molecule antagonists with respect to intracellular Ca(2+) signalling PMID: 18601911
  16. The prevalence of the TACR2 mRNA alpha isoform strongly suggests a major involvement of tachykinin NK(2) receptor in the regulation of human colonic functions. PMID: 18835556

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 11527

OMIM: 162321

KEGG: hsa:6865

STRING: 9606.ENSP00000362403

UniGene: Hs.88372

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1