Recombinant Human Substance-K receptor(TACR2)

Code CSB-CF023069HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P21452
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI
Source in vitro E.coli expression system
Gene Names TACR2
Protein Names Recommended name: Substance-K receptor Short name= SKR Alternative name(s): NK-2 receptor Short name= NK-2R Neurokinin A receptor Tachykinin receptor 2
Expression Region 1-398
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 11527

OMIM: 162321

KEGG: hsa:6865

STRING: 9606.ENSP00000362403

UniGene: Hs.88372

Pathway Calcium signaling pathway

Related Products

TACR2 Antibodies

TACR2 Antibodies for Homo sapiens (Human)

TACR2 Proteins

TACR2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.