Recombinant Human Succinate dehydrogenase cytochrome b560 subunit, mitochondrial (SDHC)

Code CSB-CF859106HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
SDHC
Uniprot No.
Alternative Names
SDHC; CYB560; SDH3; Succinate dehydrogenase cytochrome b560 subunit, mitochondrial; Integral membrane protein CII-3; QPs-1; QPs1; Succinate dehydrogenase complex subunit C; Succinate-ubiquinone oxidoreductase cytochrome B large subunit; CYBL
Species
Homo sapiens (Human)
Expression Region
30-169
Target Protein Sequence
LGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSA LLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLY QSGVVVLVLTVLSSMGLAAM
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Gene References into Functions
  1. SDHC Promoter hypermethylation is associated with Parasympathetic Paragangliomas. PMID: 29126304
  2. 31% of the paragangliomas in the French Canadian can be explained by the SDHC mutation (c.397C>T, p.[Arg133Ter]). PMID: 27700540
  3. Loss of the SDHC gene is associated with metastatic sympathetic paraganglioma. PMID: 26162468
  4. This report provides evidence that SDHC promoter methylation can cause Paragangliomas due to SDHC inactivation PMID: 26652933
  5. significant association with overall survival were confirmed for SDHC gene, SDHD gene and FH gene ... SDHC gene and FH gene were the primary factors contributing to the different overall survival time of colorectal carcinoma PMID: 26377099
  6. The discovery of SDHC epimutation provides a unifying explanation for the pathogenesis of SDH-deficient gastrointestinal stromal tumors. PMID: 25540324
  7. Variant in rs3935401 in the 3' untranslated region of SDHC is associated with hepatocellular carcinoma. PMID: 25081338
  8. these data suggest epigenetic inactivation of the SDHC gene locus with functional impairment of the SDHC as a plausible alternate mechanism of tumorigenesis in Carney Triad PMID: 24859990
  9. Thoracic paragangliomas are common in patients with SDHC mutations, and imaging of this area should be included in surveillance of mutation carriers. PMID: 24758179
  10. this study reports the first patient affected by malignant paraganglioma and< moreover, it reports two more unrelated patients with the same genotype and very different clinical presentations. PMID: 24423348
  11. No SDHC mutation were found in patients with sporadic paraganglioma. PMID: 22566194
  12. Biallelic inactivation of the SDHC gene may represent a new pathway of pathogenesis of syndromic and nonsyndromic renal cell carcinoma, perhaps of both clear cell and papillary histologies PMID: 22351710
  13. Case Report: present a 32-year-old man with a familial SDHC mutation who manifests synchronous paragangliomas of the carotid body and the thoracic aortopulmonary window. PMID: 21106325
  14. mammalian cells over expressing mutations in SDHC demonstrate low-dose/low-LET radiation sensitization that is mediated by increased levels of O*- and HO. PMID: 21268708
  15. A splice donor site mutation in SDHC is associates with autosomal dominant malignant and catecholamine-producing paraganglioma PMID: 12658451
  16. description of a large deletion in a complex II gene and confirmation of the role of SDHC in familial and sporadic paragangliomas PMID: 15342702
  17. Mutant protein in transgenic mice generates oxidative stress and can contribute to nuclear DNA damage, mutagenesis, and ultimately, tumorigenesis PMID: 15665296
  18. Germline mutations of SDHC play a minor role in sporadic head and neck paraganglioma. PMID: 16405730
  19. familial gastrointestinal stromal tumors may be caused by mutations of the succinate dehydrogenase subunit genes SDHB, SDHC, and SDHD, and abdominal paragangliomas associated with gastrointestinal tumors may be caused uniquely by SDHC mutations PMID: 17804857
  20. Gene deletions of SDHD and SDHC represent a substantial proportion of all mutations, and must be considered in paraganglioma patients shown to be negative for mutations by sequencing. PMID: 19546167

Show More

Hide All

Involvement in disease
Paragangliomas 3 (PGL3); Paraganglioma and gastric stromal sarcoma (PGGSS)
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Cytochrome b560 family
Database Links

HGNC: 10682

OMIM: 602413

KEGG: hsa:6391

STRING: 9606.ENSP00000356953

UniGene: Hs.444472

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1