Recombinant Human Thromboxane A2 receptor (TBXA2R)

Code CSB-CF023260HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
TBXA2R; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor
Species
Homo sapiens (Human)
Expression Region
1-343
Target Protein Sequence
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C.; Activates adenylyl cyclase.; Inhibits adenylyl cyclase.
Gene References into Functions
  1. Differential TBXA2 receptor transcript stability is dependent on the C924T polymorphism PMID: 28709878
  2. The tumour suppressors FOXP1 and NKX3.1, strongly implicated in PCa development, were identified as key transcription factors regulating TPbeta expression through Prm3 in both PCa cell lines. PMID: 28890397
  3. The study of patients with naturally occurring variants within TBXA2R associated with bleeding and abnormal TPalpha receptor function has provided a powerful insight in defining the critical role of TPalpha in thrombus formation. PMID: 30089223
  4. these data demonstrate that TPalpha/TPbeta can act as neoplastic and epigenetic regulators by mimicking and/or enhancing the actions of androgens within the prostate and provides further mechanistic insights into the role of the TXA2/TP signalling axis in prostate cancer, including potentially in CRPC. PMID: 28108419
  5. Data show that thromboxane A2 receptor beta-isoform (TPbeta) is highly expressed in intrauterine growth restriction (IUGR) placentae but is absent from healthy placentae. PMID: 27363493
  6. We conclude that hyperglycemia activates thromboxane A2 receptor to impair the integrity and function of blood-brain barrier via the ROCK-PTEN-Akt-eNOS pathway. PMID: 28415790
  7. data presented herein propose a novel diagnostic and prognostic potential for TPalpha and TPbeta in the histopathological assessment of PCa. While TPalpha and TPbeta are differentially expressed and independently regulated, increased levels of TPbeta, TPalpha or both correlated with increased risk of recurrence and reduced disease-free survival time. PMID: 27689401
  8. TBXA2R is a novel breast cancer-associated gene required for the survival and migratory behaviour of a subset of Triple Negative Breast Cancer (TNBC). PMID: 27487152
  9. TXA2R rs1131882TT genotype is associated with carotid plaque vulnerability, platelet activation and TXA2 levels in ischemic stroke patients. PMID: 28704403
  10. We demonstrate that Trp334 in the TPbeta C-terminus is critical for the CCT7 interaction and plays an important role in TPbeta maturation and cell-surface expression. PMID: 27708139
  11. TBXA2R +924C/T polymorphism is associated with asthma risk PMID: 27058349
  12. A considerable portion of Chinese ischemic stroke patients are insensitive to aspirin treatment, which may be correlated with the MDR1 C3435T, TBXA2R (rs1131882), and PLA2G7 (rs1051931-rs7756935) polymorphisms. PMID: 27641736
  13. Data suggest that thromboxane A2/TBXA2R signaling promotes multiple myeloma cell proliferation by reducing delay at G2/M phase via up-regulation of MAP kinase pathway, up-regulation of cyclin B1/CDK1 expression, and down-regulation of apoptosis. PMID: 26724804
  14. The results of this study show that TXA2R polymorphisms may affect platelet function and the risk of developing cerebral ischemia. PMID: 25557379
  15. Which could be attenuated by treatment with a TP antagonist (PTXA2). PMID: 25202904
  16. TXA2 receptor associated with lipid rafts in platelets is important for functional platelet responses to TXA2 PMID: 24996187
  17. Data suggest TBXA2R requires Ser324 for normal activity; Ser324A mutant is insensitive to activation by protein kinase A/cell hypoxia, has high affinity for agonists (thromboxane A2/analogs), and participates in agonist-induced calcium mobilization. PMID: 24490858
  18. There was no significant association between rs4523 variants and CI. However, there was a significant difference in the overall distribution of genotypes and dominant/recessive models of rs768963 between CI and control groups PMID: 23456445
  19. TXA2 should be regarded as a critical molecule in COX-2-mediated tumor growth and a valuable target against lung cancer. PMID: 24384873
  20. Human thromboxane A2 receptor genetic variant V80E exhibited reduced platelet activation whereas A160T demonstrated platelet hyperactivity. PMID: 23840660
  21. Targeting the TPalpha-TM5 GxxxGxxxL domain may allow development of biased TPalpha homodimer antagonists that avoid suppression of IP-TPalpha heterodimer function. PMID: 23493750
  22. Non-conservative substitution of E3.49 and E6.30 in prostanoid TP receptor results in superactive mutants that are more efficient in G protein coupling and activation. PMID: 23555978
  23. Genetic variants were identified in the TBXA2R gene that influenced transcriptional activity and were associated with asthma-related phenotypes. PMID: 23517037
  24. In the very rare disorder TP receptor deficiency the W29C substitution reduces TP receptor function by reducing surface receptor expression and by disrupting ligand binding. PMID: 23279270
  25. These results do not support that thromboxane prostanoid receptor activation could exert a moderating influence on reactive hyperemia in human skin and skeletal muscle, at least in young subjects PMID: 23107873
  26. Data show that TXA(2) mimetic, I-BOP, induced monocyte chemoattractant protein -1(MCP-1)/chemokine (C-C motif) ligand 2 (CCL2) expression at both mRNA and protein levels in lung adenocarcinoma A549 cells. PMID: 23349788
  27. The results indicate that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, has the ability to associate with each protein independently. PMID: 23255603
  28. IP receptor heteridimerization with thromboxane receptor facilitates receptor trafficking to membrane lipid rafts. PMID: 23162015
  29. Data show that that Ala160(4.53) and Gly164(4.57) in the thromboxane A2 receptor (TP)play critical structural roles in packing of TM3 and TM4 helices. PMID: 22272267
  30. The frequencies of the CC/CT genotype of TBXA2R +795T>C were higher than those of the TT genotype in AERD patients compared to aspirin-tolerant asthma patients. PMID: 22101342
  31. A unique megakaryocytic cell line UT-7/TPO could respond to one of the primary platelet signals through GP (glycoprotein) VI and a secondary signal of the AA (arachidonic acid) cascade. PMID: 20522022
  32. Studies indicate that RAD50 and PTPRE of crude associations with asthma at a Bonferroni-corrected level of significance, while IL4R, CCL5 and TBXA2R of nominal significance. PMID: 21734400
  33. The carboxyl-terminal segment of thromboxane A2 receptor second extracellular loop plays a critical role in platelet activation. PMID: 22008592
  34. TBXA2R-924T allele was involved in AR. Diabetes was an independent risk factor of aspirin resistance. PMID: 21740787
  35. The results suggest that the TBXA2R-4684T allele may be associated with lower TBXA2R expression, which may contribute to the development of the aspirin-intolerant acute urticaria phenotype. PMID: 21070398
  36. the impaired platelet activation in response to U46619 in the heterozygous subject for the TXA(2)R mutation is, at least in part, as a result of the decrease in ADP secretion PMID: 21342433
  37. angio-associated migratory cell protein was identified as a novel interacting partner of both TPalpha and TPbeta isoforms of the thromboxane A2 receptor PMID: 21172430
  38. TBXA2R signaling was regulated by oxidative stress-induced stabilization and relocation. PMID: 20856817
  39. vasoconstrictor TP receptor and MaxiK-channel direct interaction facilitates G-protein-independent TP to MaxiK trans-inhibition, which would promote vasoconstriction. PMID: 20959415
  40. mediates tumor growth and angiogenesis in human lung cancer cells PMID: 19853959
  41. possibility of ligand-free constitutive TBXA2R signaling through Galphaq binding PMID: 20590159
  42. These data establish WT1 as a critical repressor of thromboxane A2 receptor promoter Prm1, suppressing TPalpha expression. PMID: 19067769
  43. D304N substitution causes clinically significant platelet dysfunction by reducing ligand binding establishes the importance of the NPXXY motif for TxA(2)R function in vivo PMID: 19828703
  44. Prostaglandin endoperoxides and thromboxane A2 activate the same receptor isoforms in human platelets. PMID: 11848439
  45. Mapping of a ligand-binding site for the human thromboxane A2 receptor protein. PMID: 11877412
  46. These results suggest TXA2 receptor polymorphism strongly interacts with IL-4R alpha polymorphism as a major determinant of high serum immunoglobulin E levels in atopic dermatitis. PMID: 11922633
  47. The role of TXA2R 5' UTR in differential isoform expression was studied. Exons E1 & E1b associated with TXA2R transcript(s), but their expression was mutually exclusive. Major transcription initiation sites were between -115 & -92 in E1 & at -99 in E1b. PMID: 12180983
  48. Transcriptional activity of the 5'flanking region PMID: 12213432
  49. analysis of third extracellular loop of human thromboxane A2 receptor PMID: 12781781
  50. Thromboxane A2 (TXA2)-mediated platelet secretion and aggregation are important in thrombosis and the stable TXA2 analogue, U46619, induces two waves of platelet secretion, each of which precedes a distinct wave of platelet aggregation PMID: 12796499

Show More

Hide All

Involvement in disease
Bleeding disorder, platelet-type 13 (BDPLT13)
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 11608

OMIM: 188070

KEGG: hsa:6915

STRING: 9606.ENSP00000393333

UniGene: Hs.442530

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1