Recombinant Human Transmembrane 7 superfamily member 4 (TM7SF4)

Code CSB-CF023625HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
DCSTAMP
Uniprot No.
Alternative Names
DCSTAMP; TM7SF4; Dendritic cell-specific transmembrane protein; DC-STAMP; hDC-STAMP; Dendrocyte-expressed seven transmembrane protein; IL-four-induced protein; FIND; Transmembrane 7 superfamily member 4
Species
Homo sapiens (Human)
Expression Region
1-470
Target Protein Sequence
MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIA AAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKG LLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSH VLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGW KYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPI LIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISV FEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYL HAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable cell surface receptor that plays several roles in cellular fusion, cell differentiation, bone and immune homeostasis. Plays a role in TNFSF11-mediated osteoclastogenesis. Cooperates with OCSTAMP in modulating cell-cell fusion in both osteoclasts and foreign body giant cells (FBGCs). Participates in osteoclast bone resorption. Involved in inducing the expression of tartrate-resistant acid phosphatase in osteoclast precursors. Plays a role in haematopoietic stem cell differentiation of bone marrow cells toward the myeloid lineage. Inhibits the development of neutrophilic granulocytes. Plays also a role in the regulation of dendritic cell (DC) antigen presentation activity by controlling phagocytic activity. Involved in the maintenance of immune self-tolerance and avoidance of autoimmune reactions.
Gene References into Functions
  1. TM7SF4 may be involved in the progression of lung cancer. PMID: 28849122
  2. Our results suggest that the rare genetic variant of TM7SF4 gene, found in our French-Canadian cohort of patients with Paget's disease of bone and which encodes the DC-STAMP protein, increase the number of nuclei per multinucleated cells and affect DC-STAMP expression during osteoclastogenesis in Paget's disease of bone. PMID: 29145829
  3. TM7SF4 plays an essential role in regulating cell cycle progression in breast cancer. PMID: 26636523
  4. The EP in TKA differed from EP in aseptically failed THA by lower CCL3 and DC-STAMP mRNA and protein expression. EP of all studied inflammatory and osteoclastogenic molecules were similar in knee and hip OA. PMID: 25151085
  5. Our findings also suggest that next generation sequencing may help explore the pathogenesis and aid the diagnosis of Juvenile Paget's disease. PMID: 25891874
  6. Rs62620995 in the TM7SF4 gene was found to have a marginal association with Paget's disease of bone in the French-Canadian population. PMID: 24370779
  7. DC-STAMP inhibition by RNA interference consequently suppressed fusion and bone resorption of human osteoclasts. PMID: 23525827
  8. An interaction between OS9 and DC-STAMP was confirmed by yeast-2-hybrid analysis and cellular colocalization.ER-to-Golgi translocation of DC-STAMP following TLR stimulation in CHO cells was demonstrated, involving the DC-STAMP/OS9 interaction. The data indicate that OS9 is critically involved in ER-to-Golgi transport of DC-STAMP, and may be important in both myeloid differentiation and cell fusion. PMID: 18952287
  9. DC-STAMP is a potential osteoclast precursors biomarker in inflammatory arthritis. PMID: 21987375
  10. Results show that T cells played a pivotal role in a new in vitro Langhans giant cells (LGCs) formation system, in which DC-STAMP was involved, and occurred via a molecular mechanism that involved CD40-CD40L interaction and IFN-gamma secretion. PMID: 22058328
  11. DC-STAMP is an ITIM-bearing molecule. Based on the 4 distinct patterns of DCSTAMP on human PBMC, it has potential to serve as a susceptible biomarker of psoriasis (Ps) as well as severity marker of Psoriatic Arthritis (PsA). PMID: 21987375
  12. genetic risk for Paget's disease of bone is associated with variants close to CSF1, OPTN, TM7SF4, and TNFRSF11A genes PMID: 20839008
  13. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. PMID: 20546900
  14. The dendritic cell-specific transmembrane protein is a multimembrane-spanning protein preferentially expressed by human DC (hDC). PMID: 15601667
  15. 2 differentially expressed genes over-expressed in papillary thyroid cancers were identified as DC-STAMP and type I collagen A1 PMID: 19259350

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endosome.
Tissue Specificity
Preferentially expressed by dendritic cells (DCs). Detected in both immature and mature DCs. Highly expressed in lymph nodes, lung, kidney and liver. Expressed at lower levels in pancreas, bone marrow, spleen, leukocytes, in freshly isolated peripheral bl
Database Links

HGNC: 18549

OMIM: 605933

KEGG: hsa:81501

STRING: 9606.ENSP00000297581

UniGene: Hs.652230

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1