Recombinant Human Transmembrane protease serine 3(TMPRSS3)

Code CSB-CF023925HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P57727
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT
Source in vitro E.coli expression system
Gene Names TMPRSS3
Protein Names Recommended name: Transmembrane protease serine 3 EC= 3.4.21.- Alternative name(s): Serine protease TADG-12 Tumor-associated differentially-expressed gene 12 protein
Expression Region 1-454
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable serine protease that plays a role in hearing. Acts as a permissive factor for cochlear hair cell survival and activation at the onset of hearing and is required for saccular hair cell survival (By similarity). Activates ENaC (in vitro).
Involvement in disease Deafness, autosomal recessive, 8 (DFNB8)
Subcellular Location Endoplasmic reticulum membrane, Single-pass type II membrane protein
Protein Families Peptidase S1 family
Tissue Specificity Expressed in many tissues including fetal cochlea. Isoform T is found at increased levels in some carcinomas.
Database Links

HGNC: 11877

OMIM: 601072

KEGG: hsa:64699

STRING: 9606.ENSP00000291532

UniGene: Hs.208600

Related Products

TMPRSS3 Antibodies

TMPRSS3 Antibodies for Homo sapiens (Human)

TMPRSS3 Proteins

TMPRSS3 Proteins for Homo sapiens (Human)

TMPRSS3 ELISA Kit

TMPRSS3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.