Recombinant Human Transmembrane protein 184A(TMEM184A)

Code CSB-CF023769HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6ZMB5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MSNVSGILETAGVPLVSANWPQPSPPPAVPAGPQMDHMGNSSQGAPWLFLTSALARGVSG IFVWTALVLTCHQIYLHLRSYTVPQEQRYIIRLLLIVPIYAFDSWLSLLLLGDHQYYVYF DSVRDCYEAFVIYSFLSLCFQYLGGEGAIMAEIRGKPIKSSCLYGTCCLRGMTYSIGFLR FCKQATLQFCLVKPVMAVTTIILQAFGKYHDGDFNVRSGYLYVTLIYNASVSLALYALFL FYFTTRELLRPFQPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVETSGGNKLGAGTL AAGYQNFIICVEMLFASVALRYAFPCQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIV QDAIHNFSPAYQHYTQQATHEAPRPGTHPSGGSGGSRKSRSLEKRMLIPSEDL
Source in vitro E.coli expression system
Gene Names TMEM184A
Protein Names Recommended name: Transmembrane protein 184A
Expression Region 1-413
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as a heparin receptor in vascular cells (By similarity). May be involved in vesicle transport in exocrine cells and Sertoli cells (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein, Cytoplasm, perinuclear region, Cytoplasmic vesicle membrane, Multi-pass membrane protein, Early endosome membrane, Multi-pass membrane protein, Endosome, Cytoplasmic vesicle, secretory vesicle membrane
Protein Families TMEM184 family
Tissue Specificity Expressed in vascular cells (at protein level).
Database Links

HGNC: 28797

KEGG: hsa:202915

STRING: 9606.ENSP00000297477

UniGene: Hs.592174

Related Products

TMEM184A Proteins

TMEM184A Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.