Recombinant Human Transmembrane protein 18 (TMEM18)

Code CSB-CF023763HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
TMEM18
Uniprot No.
Alternative Names
TMEM18; Transmembrane protein 18
Species
Homo sapiens (Human)
Expression Region
1-140
Target Protein Sequence
MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLV ILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVM TDLKNAQERRKEKKRRRKED
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC).
Gene References into Functions
  1. Significant associations were identified at 3.5 years old for TMEM18 rs6548238, NEGR1 rs2815752, BDNF rs10767664 and rs6265 (1 year old and 3.5 years old) with anthropometric phenotypes PMID: 27005443
  2. Studies indicate association of transmembrane protein 18 (TMEM18) variants within the proximal haplotype block with obesity and body mass. PMID: 26365393
  3. rs186019316 and rs7596758 in TMEM18 is associated with body mass index. PMID: 24951660
  4. TMEM18 mRNA expression levels are related to phenotypes of obesity and glucose metabolism. PMID: 24763707
  5. In summary, moderately rare missense variants within the...TMEM18 genes observed in our study did not confer risk of common childhood obesity in African Americans... PMID: 23505181
  6. Results imply a regulatory role for TMEM18, BDNF, MTCH2 and NEGR1 in adipocyte differentiation and biology. In addition, we show a variation of MAF expression during adipogenesis, while NPC1, PTER and SH2B1 were not regulated. PMID: 23229156
  7. TMEM18rs6548238 associated with risk of diabetes after adjustment for body mass index. PMID: 22466342
  8. Meta-analysis of 4992 subjects revealed seven SNPs near four loci, including NEGR1, TMEM18, SH2B1 /ATP2A1 and MC4R, showing significant association at 0.005 PMID: 21750520
  9. The polymorphisms rs6548238 and rs9935401 showed no association with educational level or income. PMID: 20628085
  10. Our data suggest that SNPs in or near the TMEM18 locus contribute to obesity risk in the Greek population. PMID: 21720444
  11. We observed a strong positive correlation between TMEM18 expression and body weight in the prefrontal cortex (PFC) (r = 0.5694, P = 0.0003) indicating a potential role for TMEM18 in higher functions related to feeding involving the PFC. PMID: 21952719
  12. TMEM18 localises to the nuclear membrane and binds to DNA in a sequence-specific manner: perhaps this closed perinuclear localisation of TMEM18-bound DNA might repress transcription from it. PMID: 21980424
  13. The risk allele TMEM18 rs6548238 was associated with bodym mass index, higher waist circumference and total body fat. PMID: 19910938
  14. TMEM18 is involved in both adult and childhood obesity and found in the majority of all brain sites, including the hypothalamus and the brain stem. PMID: 20380707
  15. Overexpression of TMEM18 is associated with glioma PMID: 18559506

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus membrane; Multi-pass membrane protein.
Protein Families
TMEM18 family
Database Links

HGNC: 25257

OMIM: 613220

KEGG: hsa:129787

STRING: 9606.ENSP00000281017

UniGene: Hs.43899

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1