Recombinant Human Transmembrane protein 236(TMEM236)

Code CSB-CF736211HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5W0B7
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MASGRLIKFVVFELLEFAAFSIPTLVITEQFATAYQGTRARSDNTHYWLIISCSIAYVAL VTLLIWVPVKVILHKKRYIYRKIKGWRPVLMMCVVLTTLPCLTFSIAVTEVQKSINGSAD VLPDMLPDLPVSLVLLSLIMVDIIEKLRIYPLRGSQKSSENGHIHSTSLQHIKTVTEQVR QSPENAASPQATNSTQVSQPSGAMTRSQESVFMGPQEPSCDSGILRMMSRRDVRAELFLW SFLLWSDTIEMVRVAGHPNVYKSSWLYPVYIFSFISLLRITFTPQNPLLNSLSVLLQDLP FVFVRLGLIIALGTITPVLGLCKNILVTLSYIYFNYLTRIRIFSAFEMSPF
Source in vitro E.coli expression system
Gene Names TMEM236
Protein Names Recommended name: Transmembrane protein 236
Expression Region 1-351
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families TMEM236 family
Database Links

HGNC: 23473

KEGG: hsa:653567

STRING: 9606.ENSP00000414144

UniGene: Hs.564139

Related Products

TMEM236 Proteins

TMEM236 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.