Recombinant Human Protein myomaker (MYMK)

In Stock
Code CSB-CF407391HU
Abbreviation Recombinant Human MYMK protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
MYMK
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-221aa
Target Protein Sequence
MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFSVYGTALSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILIIAAKWLQKMKEKKGLYPDKSVYTQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAKLDCSTLCCACV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Protein myomaker (MYMK) is produced using an E.coli-based cell-free expression system, covering the full length of 1-221 amino acids. The protein features an N-terminal 10xHis-tag, which helps with purification and detection. It achieves a purity greater than 85% as determined by SDS-PAGE. The protein includes a 7-transmembrane domain and is presented using our proprietary Detergent Platform, ensuring optimal stability and functionality for research applications.

Myomaker appears to be a protein that's essential for muscle cell fusion—a process that seems crucial for muscle development and regeneration. It's involved in forming multinucleated muscle fibers and plays what may be a vital role in myogenesis. Studying this protein is likely important for understanding various muscle-related pathways and conditions, which makes it a significant focus in research on muscle biology and related disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The human MYMK is a multi-pass transmembrane protein with 7 transmembrane domains that requires proper integration into a lipid bilayer and correct folding for its bioactivity in mediating myoblast membrane fusion. While cell-free systems can improve solubility compared to traditional E. coli expression, they still lack the native membrane environment necessary for proper folding and integration of complex transmembrane proteins. The detergent used for solubilization may not replicate the natural lipid environment, potentially leading to non-native conformations. Without experimental validation (e.g., membrane integration assays or functional fusion assays), the protein cannot be assumed to be correctly folded or bioactive.

1. Membrane Protein Reconstitution Studies

This application is feasible but requires validation. The recombinant MYMK can be incorporated into artificial lipid bilayers to study membrane integration. However, if the protein is misfolded during expression, reconstitution may not yield functional protein. Validate membrane integration using techniques like fluorescence quenching or protease protection assays before concluding native behavior.

2. Protein-Protein Interaction Screening

Use with caution. The His-tag enables pull-down assays, but if MYMK is misfolded, interactions may be non-physiological. MYMK requires correct membrane integration and conformation for proper interactions with fusion partners. Validate any identified interactions using full-length MYMK expressed in mammalian cells or confirm with complementary methods like co-immunoprecipitation from myoblasts.

3. Antibody Development and Validation

This application is suitable. The recombinant MYMK can serve as an immunogen for generating antibodies against linear epitopes, even if misfolded. The high purity supports consistent immunization. However, antibodies generated may not recognize conformational epitopes of native, membrane-embedded MYMK. Validate antibody specificity against MYMK expressed in mammalian cells or endogenous MYMK in myoblasts.
4. Membrane Protein Biochemical Characterization
This recombinant human MYMK is suitable for basic biophysical analysis of the detergent-solubilized protein (e.g., thermal stability, aggregation state). However, data may not reflect native MYMK properties due to potential misfolding and detergent effects. Use techniques like circular dichroism to assess secondary structure, but interpret results cautiously without validation of membrane integration capability.

Final Recommendation & Action Plan

Before using this recombinant MYMK for functional studies, validate its folding and membrane integration capability. First, analyze secondary structure via circular dichroism and check oligomeric state via size-exclusion chromatography. Most critically, test membrane integration by reconstituting into proteoliposomes and assessing topology using protease protection assays. If possible, perform functional assays by co-expressing with MyoMixer in heterologous cells to test fusion activity. If active, proceed with interaction studies; if inactive, limit use to non-functional applications like antibody production (with validation against native MYMK). For reliable results, consider expressing MYMK in mammalian cells that provide proper membrane environments. Always include appropriate controls with native MYMK when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Myoblast-specific protein that mediates myoblast fusion, an essential step for the formation of multi-nucleated muscle fibers. Actively participates in the membrane fusion reaction by mediating the mixing of cell membrane lipids (hemifusion) upstream of MYMX. Acts independently of MYMX. Involved in skeletal muscle regeneration in response to injury by mediating the fusion of satellite cells, a population of muscle stem cells, with injured myofibers. Also involved in skeletal muscle hypertrophy, probably by mediating the fusion of satellite cells with myofibers.
Gene References into Functions
  1. The data establish that MYMK activity is necessary for normal muscle development and maintenance in humans and zebrafish, and expand the spectrum of congenital myopathies to include cell-cell fusion deficits. PMID: 28681861
Involvement in disease
Carey-Fineman-Ziter syndrome (CFZS)
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Protein Families
TMEM8 family
Database Links

HGNC: 33778

OMIM: 254940

KEGG: hsa:389827

UniGene: Hs.512467

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*