Recombinant Human UDP-glucuronosyltransferase 2B17 (UGT2B17)-VLPs

Code CSB-MP025590HU
MSDS
Size
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
UGT2B17
Uniprot No.
Research Area
Metabolism
Alternative Names
(UDPGT 2B17)(UGT2B17)(C19-steroid-specific UDP-glucuronosyltransferase)(C19-steroid-specific UDPGT)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
24-530aa
Target Protein Sequence
GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex. Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile. Catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol).
Gene References into Functions
  1. These data can be used to predict variability in the metabolism of UGT2B17 substrates. PMID: 29602798
  2. UGT2B17 was deleted in 64% of children with lymphoblastic malignancy, but in 83% of children with non-lymphoblastic malignancy. UGT2B17 deletion polymorphism may improve the relapse-free rate in children with non-lymphoblastic malignancy. PMID: 27805301
  3. Study provides the first evidence of null genotype involvement in UGT2B17 as a risk factor for benign prostatic hyperplasia. PMID: 28882566
  4. Chronic lymphocytic leukemia patients with high UGT2B17 and LPL expression have significantly reduced survival. PMID: 26589911
  5. UGT2B17 contributes to the in-vitro glucuronidation of arctigenin in liver/intestinal microsomes. PMID: 26407805
  6. GC-C-IRMS analysis sensitive to testosterone doping independent of UGT2B17 genotype. PMID: 26198073
  7. UGT2B17 mismatch has a negative clinical impact in allogeneic HSCT from HLA-identical sibling donors only when a male donor is used. PMID: 26367234
  8. This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen. PMID: 26176234
  9. UGT2B17 deletion polymorphisms are associated with the risk of developing pancreatic cancer in Chinese Han population, especially in the female population. PMID: 26882814
  10. UGT2B17-deletion interacting with p16 (+) may modify effects of smoking on TP53-mutations and may further interact with the disruptive TP53-mutations to raise relapse rates among Japanese patients with head and neck squamous cell carcinomas. PMID: 25886176
  11. These data suggest that UGT2B17 deletion leads to reduced UGT2B17 activity, and lower BMI in male individuals. This is consistent with the hypothesis that reduced UGT2B17-mediated testosterone excretion results in higher testosterone levels PMID: 25794161
  12. The UGT2B17 deletion polymorphism is not associated with tumor risks. PMID: 24802609
  13. Structural variants unique to the malignant cell line inactivated: UGT2B17, a gene that inactivates dihydrotestosterone, a known activator of prostate cancer progression. PMID: 23792589
  14. Variation in 3HC glucuronidation activity by CYP2A6 caused by UGT2B17 gene deletions did not significantly alter nicotine metabolite ratio in smokers. PMID: 23936477
  15. UGT2B17 is a possible target for androgen deprivation therapy of prostate cancer. PMID: 24121496
  16. Study indicates that UGT2B17 is not a crucial factor in lung carcinogenesis among Caucasians and shows the importance of investigating such markers in large cohorts from different populations. PMID: 23850147
  17. association of the UGT2B17 CNV with AS is particularly interesting given the recent association of this CNV with osteoporosis and the proposed function as it encodes a key enzyme that inhibits androgens PMID: 23927372
  18. The prevalence of the UGT2B17 deletion genotype is extremely high in Japanese subjects. PMID: 22887913
  19. We observed a significant association between UGT2B17 expressing recipients and UGT2B17 deficient donors with the severity of Acute graft versus host disease. PMID: 22726315
  20. The androgen receptor assay may serve as a complement to the urinary testosterone/epitestosterone (T/E) doping test, because this is profoundly influenced by the UGT2B17 deletion polymorphism. PMID: 23294483
  21. Report UGT2B17 expression in fetal/adult tissues. PMID: 23223495
  22. The present study was aimed to investigate the possible association between 19-base pair (bp) deletion polymorphism of the DHFR gene (rs70991108), null genotype of UGT2B17 as well as the expression level of NGX6 with the risk of breast cancer. PMID: 23053953
  23. Data from an in vitro supersome/microsome-based assay suggest that the key steroid-metabolizing enzyme UGT2B17 is inhibited by phenolic dietary substances in red wine and therefore may reduce the rate of testosterone glucuronidation in vivo. PMID: 22958586
  24. observed an exclusive involvement of the 2B17 isoform within the UGT protein family in poor-risk chronic lymphocytic leukemia PMID: 23169782
  25. Genetic variations in the UGT2B17 gene dramatically affect the pharmacokinetics of MK-7246 in healthy subjects. PMID: 22669291
  26. The UGT2B17 Del polymorphism may significantly contribute to prostate cancer susceptibility in men. (Meta-analysis) PMID: 21919858
  27. UGT2B17 gene deletion associated with an increase in bone mineral density similar to the effect of hormone replacement in postmenopausal women PMID: 21614655
  28. we found no evidence of an effect of UGT2B17 CNV on osteoporosis risk in elderly Caucasian women. PMID: 20878390
  29. Data show that 698 CNPs loci overlap with known disease-associated or pharmacogenetic-related genes such as CFHR3, CFHR1, GSTTI and UGT2B17. PMID: 21677662
  30. data suggest that men have a higher amount of UGT2B17 glucuronidation activity then women PMID: 20810538
  31. UGT2B17 expression in prostate cancer is regulated by a novel polymorphism in forkhead boxA1 binding site. PMID: 20628005
  32. Overexpression of UGT2B17 is associated with endometrial cancer. PMID: 20554747
  33. the association of deletion polymorphism in the UGT2B17 gene with the occurrence of renal disorders on chronic exposure to anabolic androgenic steroids PMID: 20429943
  34. Observational study of genetic testing. (HuGE Navigator) PMID: 20192879
  35. UGT2B17 deletion polymorphism is associated with a reduced rate of NNAL detoxification in vivo and may increase individual susceptibility to tobacco-related cancers. PMID: 16220109
  36. The UGT2B17 polymorphism is strongly associated with the bimodal distribution of testosterone excretion and also with the large difference in testosterone excretion between Koreans and Swedes. PMID: 16332934
  37. Deletion polymorphism of UDP-glucuronosyltransferase 2B17 is associated with prostate cancer PMID: 16896035
  38. The UGT2B17 deletion polymorphism is associated with prostate cancer risk. PMID: 17387331
  39. association of the UGT2B17 deletion with increased lung adenocarcinoma in women is consistent with its association with decreased 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanol glucuronidation rates in women PMID: 17416778
  40. results suggest that the HSD3B1 N367T and UGT2B17 null polymorphisms may modify the risk of prostate cancer, particularly among men with a family history of the disease PMID: 17826523
  41. These findings show that the UGT2B17 deletion polymorphism is not associated with prostate cancer risk in Caucasians. PMID: 17935910
  42. The UGT2B17 deletion polymorphism does not play a major role in prostate cancer susceptibility as previously indicated. PMID: 18247404
  43. UGT2B17 ia a primary androgen-regulated genes and androgen receptor is required for basal expression and androgen-regulated expression. PMID: 18302198
  44. Diversity was unusually high, with evidence of balancing selection in Europe. In contrast, diversity was low in East Asia where a single haplotype predominated, suggesting positive selection for the deletion in this part of the world PMID: 18760392
  45. Genome-wide copy-number variation identified a susceptibility gene, UGT2B17, for osteoporosis. PMID: 18992858
  46. In pubertal boys, a common homozygous deletion in the UGT2B17 gene strongly affected urinary excretion pattern of androgen metabolites but did not influence circulating androgen levels. PMID: 19088161
  47. Large testosterone excretion is associated with a deletion polymorphism of the UGT2B17 gene. This polymorphism decreases T/E ratio level. PMID: 19224506
  48. Copy-number variations (CNVs) of the human sex steroid metabolizing genes UGT2B17 PMID: 19572376

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
UDP-glycosyltransferase family
Tissue Specificity
Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.
Database Links

HGNC: 12547

OMIM: 601903

KEGG: hsa:7367

STRING: 9606.ENSP00000320401

UniGene: Hs.575083

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*