Recombinant Human Urotensin-2 receptor (UTS2R)

Code CSB-CF891728HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
UTS2R
Uniprot No.
Alternative Names
UTS2R; GPR14; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; Urotensin II receptor; UR-II-R
Species
Homo sapiens (Human)
Expression Region
1-389
Target Protein Sequence
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS SCSPQPTDSLVLAPAAPARPAPEGPRAPA
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. ligand-induced activation of the chemokine receptor CXCR4 and the urotensin 2 receptor UTS2R, triggers a marked reduction in the biogenesis of autophagosomes. PMID: 27715446
  2. The role of Urotensin-II receptor in vasoconstriction and in the development of digestive tract cancers PMID: 27338741
  3. UII/GPR14 signaling was involved in the DSS-induced colonic inflammation and its inhibition may serve as a potential therapeutic target, which may be associated with the NF-kappaB signaling pathway. PMID: 27600191
  4. UTII-R expression on biopsy was associated with Gleason upgrading and pathology upstaging in prostate cancer patients. PMID: 26381851
  5. Urotensin II can induce the proliferation of BEL-7402 cells via the urotensin receptor mediated PKC/ERK/p38 MAPK signaling pathways. PMID: 25514221
  6. Report interaction of urantide with urotensin II receptor. PMID: 24357333
  7. UTR protein and mRNA levels were increased in colon cancer cell lines and in colon adenoma and adenocarcinoma. UTR appears to be involved in the regulation of colon cancer cell invasion and motility. PMID: 24372535
  8. High UTR expression is an independent prognostic factor of good prognosis for non muscle invasive bladder transitional cancer. PMID: 24893613
  9. family-based analysis of association between blood pressure, glomerular filtration and genes of the urotensin-II pathway (urotensin-II, urotensin-II related peptide, urotensin-II receptor) saturated with 28 tagging single nucleotide polymorphisms PMID: 24391740
  10. Data suggest that UTS2R in aortic endothelium is involved in development of diabetes-associated atherosclerosis; diabetes-associated plaque development is attenuated by urotensin II/UTS2R antagonism in in vitro setting. PMID: 23344731
  11. presence of functional nuclear UT in various rat and monkey tissues as well as in human cell lines PMID: 22245063
  12. Urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in the regulation of motility of prostate adenocarcinoma cells. PMID: 21080343
  13. hUII may deteriorate monocrotaline-induced cardiac hypertrophy mainly through a vasoconstriction of the pulmonary artery and partly through the suppression of ANP secretion. PMID: 20870804
  14. This study demonstrates that UT receptor is expressed on the endothelium of HCC. U-II/UT receptor system is involved in HCC function and it involves endothelium and NO pathway. PMID: 19788716
  15. An increased sensitivity to U-II in preeclampsia might be achieved by upregulation of placental U-II receptors. PMID: 20479331
  16. These findings suggest that the intrahepatic UII/UT system has an important pathophysiological role in cirrhosis and portal hypertension. PMID: 20428787
  17. urotensin II receptor (U2R) is up-regulated by interferon-gamma PMID: 14753294
  18. monocytes and macrophages were the largest producers of GPR14 mRNA, with relatively little expression in foam cells, lymphocytes, and platelets. PMID: 15306183
  19. Subjects with S89N amino acid substitution are more insulin-resistant and thus more susceptible to type 2 diabetes mellitus development. PMID: 15476949
  20. Since both mRNA for UT receptor and U-II binding were still present. ANG II receptors were also present as shown by ANG II-induced calcium mobilization. PMID: 15752584
  21. Diagnostic reagent kits using human rhabdomyosarcoma cells expressing UTS2R were compared. PMID: 17537987
  22. GPR14 is a candidate for the guanylate cyclase independent receptor for guanylin peptides. PMID: 17595527
  23. Cloning and functional characterization of the human UT receptor gene promoter revealed the presence of NF-kappaB-binding sites involved in UT receptor gene expression PMID: 17617581
  24. Data show that both urotensin II and urotensin II receptor are expressed in adrenal tumors and attached non-neoplastic adrenal tissues, and suggest possible roles of UII and UT-R in tumor growth and/or secretion. PMID: 17686550
  25. REsults describe the differential expression of urotensin II receptors in cardiovascular tissues from rats and humans and suggest that it may account for the diverse vascular actions reported for urotensin-II. PMID: 17905478
  26. To understand the molecular interactions of hU-II and certain antagonists with the hUT-II receptor, a model of the hUT-II receptor in an active conformation with all its connecting loops was constructed by homology modeling. PMID: 18409194
  27. Results describe the solution structure of urotensin-II receptor extracellular loop III and characterize its interaction with urotensin-II. PMID: 18423797
  28. Urotensin II receptor activation in vivo enhanced the adrenocortical expression of immunoreactive aldosterone synthase. PMID: 19001524
  29. Demonstrate an important role for UTS2R in the pathogenesis of atherosclerosis. The use of UTS2R receptor antagonists may provide a beneficial tool in the management of this debilitating disease process. PMID: 19111831

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Most abundant expression in the heart and pancreas.
Database Links

HGNC: 4468

OMIM: 600896

KEGG: hsa:2837

STRING: 9606.ENSP00000323516

UniGene: Hs.192720

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1