Recombinant Human V-set and transmembrane domain-containing protein 1 (VSTM1)

Code CSB-CF747633HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
VSTM1; UNQ3033/PRO9835; V-set and transmembrane domain-containing protein 1; Signal inhibitory receptor on leukocytes-1; SIRL-1
Species
Homo sapiens (Human)
Expression Region
17-236
Target Protein Sequence
YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAE NEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTI FVAIFSCISILLLFLSVFIIYRCSQHSSSSEESTKRTSHSKLPEQEAAEADLSNMERVSL STADPQGVTYAELSTSALSEAASDTTQEPPGSHEYAALKV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Behaves as a cytokine, promoting IL17A secretion by CD4+ T-cells, and differentiation and activation of IL17 producing helper T-cells (TH17).; Inhibitory immune receptor involved in the regulation of phagocytes.
Gene References into Functions
  1. VSTM1 rs612529T is associated with a complete demethylation of the VSTM1 promoter and allele-specific upregulation of SIRL-1 expression in monocytes. PMID: 28219444
  2. findings show that SIRL-1 attenuates neutrophil extracellular traps (NET) release by neutrophils in response to distinct triggers, including opsonized Staphylococcus aureus and inflammatory danger signals; define SIRL-1 as an intervention point of benefit to suppress neutrophil extracellular trap formation in disease while preserving intracellular antimicrobial defense PMID: 27016607
  3. VSTM1-v2 might be a biomarker of rheumatoid arthritis (RA) and a novel factor in the pathogenesis of RA. PMID: 26760041
  4. we report a potential leukocyte differentiation antigen gene VSTM1 (V-set and transmembrane domain-containing 1) that was downregulated in bone marrow cells from leukemia patients and exhibited a higher degree of promoter methylation PMID: 25887911
  5. Signaling via the inhibitory receptor SIRL-1 was induced by ligation with anti-SIRL-1 specific antibodies. PMID: 24205237
  6. SIRL-1 negatively regulates the oxidative burst in human phagocytes. PMID: 23436183
  7. Signal inhibitory receptor on leukocytes-1 is a member of immunoglobulin superfamily ITIM; expressed by myeloid but not lymphoid cells; requires both of its ITIMs for full inhibition of Fc epsilon receptor type I-mediated mast cell degranulation. PMID: 20375307

Show More

Hide All

Subcellular Location
[Isoform 1]: Membrane; Single-pass membrane protein.; [Isoform 2]: Secreted.
Tissue Specificity
Expressed on myeloid (neutrophils, eosinophils and monocytes) but not on lymphoid cells.
Database Links

HGNC: 29455

KEGG: hsa:284415

UniGene: Hs.444431

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×