Recombinant Human V-set and transmembrane domain-containing protein 2B(VSTM2B)

Code CSB-CF025936HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6NLU5
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence AFTEVPKDVTVREGDDIEMPCAFRASGATSYSLEIQWWYLKEPPRELLHELALSVPGARSKVTNKDATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQAMLRVLSRFAPPNMQAAEAVSHIQSSGPRRHGPASAANANNAGAASRTTSEPGRGDKSPPPGSPPAAIDPAVPEAAAASAAHTPTTTVAAAAAASSASPPSGQAVLLRQRHGSGTGRSYTTDPLLSLLLLALHKFLRLLLGH
Source in vitro E.coli expression system
Gene Names VSTM2B
Protein Names Recommended name: V-set and transmembrane domain-containing protein 2B
Expression Region 29-285
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

HGNC: 33595

KEGG: hsa:342865

UniGene: Hs.451618

Related Products

VSTM2B Proteins

VSTM2B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.