Recombinant Human Vesicle-associated membrane protein 5(VAMP5)

Code CSB-CF025784HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O95183
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
Source in vitro E.coli expression system
Gene Names VAMP5
Protein Names Recommended name: Vesicle-associated membrane protein 5 Short name= VAMP-5 Alternative name(s): Myobrevin
Expression Region 1-116
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
Subcellular Location Cell membrane, Single-pass type IV membrane protein, Endomembrane system, Single-pass type IV membrane protein, Golgi apparatus, trans-Golgi network membrane, Single-pass type IV membrane protein
Protein Families Synaptobrevin family
Database Links

HGNC: 12646

OMIM: 607029

KEGG: hsa:10791

STRING: 9606.ENSP00000305647

UniGene: Hs.534373

Related Products

VAMP5 Antibodies

VAMP5 Antibodies for Homo sapiens (Human)

VAMP5 Antibodies for Human

VAMP5 Proteins

VAMP5 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.