Recombinant Human Vomeronasal type-1 receptor 1(VN1R1)

Code CSB-CF861973HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9GZP7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Homo sapiens (Human)
Sequence MVGDTLKLLSPLMTRYFFLLFYSTDSSDLNENQHPLDFDEMAFGKVKSGISFLIQTGVGI LGNSFLLCFYNLILFTGHKLRPTDLILSQLALANSMVLFFKGIPQTMAAFGLKYLLNDTG CKFVFYYHRVGTRVSLSTICLLNGFQAIKLNPSICRWMEIKIRSPRFIDFCCLLCWAPHV LMNASVLLLVNGPLNSKNSSAKNNYGYCSYKASKRFSSLHAVLYFSPDFMSLGFMVWASG SMVFFLYRHKQQVQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVA NPGQWIVTNSVLVASCFPARSPFVLIMSDTHISQFCFACRTRKTLFPNLVVMP
Source in vitro E.coli expression system
Gene Names VN1R1
Protein Names Recommended name: Vomeronasal type-1 receptor 1 Alternative name(s): G-protein coupled receptor GPCR24 Short name= hGPCR24 V1r-like receptor 1 V3r-related gene protein Vomeronasal olfactory receptor chromosome 19 subtype I membe
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in the olfactory mucosa, very low expression in brain, lung and kidney.
Database Links

HGNC: 13548

OMIM: 605234

KEGG: hsa:57191

STRING: 9606.ENSP00000322339

UniGene: Hs.677423

Related Products

VN1R1 Antibodies

VN1R1 Antibodies for Human

VN1R1 Antibodies for Homo sapiens (Human)

VN1R1 Proteins

VN1R1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.