Recombinant Human Vomeronasal type-1 receptor 5(VN1R5)

Code CSB-CF801813HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7Z5H4
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence MLKLVIIENMAEIMLFSLDLLLFSTDILCFNFPSKMIKLPGFITIQIFFYPQASFGISAN TILLLFHIFTFVFSHRSKSIDMIISHLSLIHILLLFTQAILVSLDFFGSQNTQDDLRYKV IVFLNKVMRGLSICTPCLLSVLQAIISPSIFSLAKLKHPSASHILGFFLFSWVLNMFIGV IFCCTLRLPPVKRGQSSVCHTALFLFAHELHPQETVFHTNDFEGCHLYRVHGPLKRLHGD YFIQTIRGYLSAFTQPACPRVSPVKRASQAILLLVSFVFTYWVDFTFSFSGGVTWINDSL LVWLQVIVANSYAAISPLMLIYADNQIFKTLQMLWFKYLSPPKLMLKFNRQCGSTKK
Source in vitro E.coli expression system
Gene Names VN1R5
Protein Names Recommended name: Vomeronasal type-1 receptor 5 Alternative name(s): G-protein coupled receptor GPCR26 Short name= hGPCR26 V1r-like receptor 5
Expression Region 1-357
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

HGNC: 19870

KEGG: hsa:317705

UniGene: Hs.553686

Related Products

VN1R5 Antibodies

VN1R5 Antibodies for Homo sapiens (Human)

VN1R5 Antibodies for Human

VN1R5 Proteins

VN1R5 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.