Home
Protein
Transmembrane Proteins
Recombinant Human coronavirus NL63 Non-structural protein 3 (3)

Recombinant Human coronavirus NL63 Non-structural protein 3 (3)

in vitro E.coli expression system

Code	CSB-CF754294HIX
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Uniprot No.

Q6Q1S1

Alternative Names

3; Non-structural protein 3; Protein 3; ns3; Accessory protein 3a

Species

Human coronavirus NL63 (HCoV-NL63)

Expression Region

1-225

Target Protein Sequence

MPFGGLFQLTLESTINKSVANLKLPPHDVTVLRDNLKPVTTLSTITAYLLVSLFVTYFAL FKPLTARGRVACFVLKLLTLFVYVPLLVLFGMYLDSFIIFSTLLFRFIHVGYYAYLYKNF SFVLFNVTKLCFVSGKCWYLEQSFYENRFAAIYGGDHYVVLGGETITFVSFDDLYVAIRG SCEKNLQLMRKVDLYNGAVIYIFAEEPVVGIVYSSQLYEDVPSIN

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Description

To produce recombinant HCoV-NL63 Non-structural protein 3 protein, a well-established recombinant DNA technology is the key. A DNA template of Non-structural protein 3 was constructed with N-terminal 10xHis tag using the technique. Once the template was made, the recombinant HCoV-NL63 Non-structural protein 3 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 1-225aa of the HCoV-NL63 Non-structural protein 3.

Human coronavirus NL63 non-structural protein 3 (Nsp3) is a viral protease involved in viral protein biogenesis, replication/transcription complex (RTC) formation, and regulation of host ubiquitinylation and ISGylation. Nsp3 exerts multiple roles in the viral life cycle. It can functions as a scaffold protein by interacting with itself and other proteins including viral Nsps and host proteins.