Recombinant Human coronavirus OC43 Hemagglutinin-esterase(HE)

Code CSB-CF326954HIY
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names HE
Uniprot No. P30215
Alternative Names HE; 2b; Hemagglutinin-esterase; HE protein; EC 3.1.1.53; E3 glycoprotein
Species Human coronavirus OC43 (HCoV-OC43)
Expression Region 17-424
Target Protein Sequence FYNPPTNVVSHVNGDWFLFGDSRSDCNHIVNINPHNYSYMDLNPVLCDSGKISSKAGNSI FRSFHFTDFYNYTGEGQQIIFYEGVNFTPYHAFKCNRSGSNDIWMQNKGLFYTQVYKNMA VYRSLTFVNVPYVYNGSAQSTALCKSGSLVLNNPAYIAPQANSGDYYYKVEADFYLSGCD EYIVPLCIFNGKFLSNTKYYDDSQYYFNKDTGVIYGLNSTETITTGFDLNCYYLVLPSGN YLAISNELLLTVPTKAICLNKRKDFTPVQVVDSRWNNARQSDNMTAVACQPPYCYFRNST TNYVGVYDINHGDAGFTSILSGLLYNSPCFSQQGVFRYDNVSSVWPLYPYGRCPTAADIN NPDLPICVYDPLPVILLGILLGVAVIIIVVLLLYFMVDNGTRLHDA
Protein Length Full Length of Mature Protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Structural protein that makes short spikes at the surface of the virus. Contains receptor binding and receptor-destroying activities. Mediates de-O-acetylation of N-acetyl-9-O-acetylneuraminic acid, which is probably the receptor determinant recognized by the virus on the surface of erythrocytes and susceptible cells. This receptor-destroying activity is important for virus release as it probably helps preventing self-aggregation and ensures the efficient spread of the progeny virus from cell to cell. May serve as a secondary viral attachment protein for initiating infection, the spike protein being the major one. Seems to be a 'luxury' protein that is not absolutely necessary for virus infection in culture. However, its presence in the virus may alter its pathogenicity. May become a target for both the humoral and the cellular branches of the immune system (By similarity).
Subcellular Location Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein
Protein Families Influenza type C/coronaviruses hemagglutinin-esterase family

  Tel: 301-363-4651
  Email: [email protected]
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1