Recombinant Human cytomegalovirus G-protein coupled receptor homolog UL33(UL33)

Code CSB-CF323471HWV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P16849
Storage Buffer Tris-based buffer,50% glycerol
Species Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Sequence MDTIIHNSTRNNTPPHINDTCNMTGPLFAIRTTEAVLNTFIIFVGGPLNAIVLITQLLTN RVLGYSTPTIYMTNLYSTNFLTLTVLPFIVLSNQWLLPAGVASCKFLSVIYYSSCTVGFA TVALIAADRYRVLHKRTYARQSYRSTYMILLLTWLAGLIFSVPAAVYTTVVMHHDANDTN NTNGHATCVLYFVAEEVHTVLLSWKVLLTMVWGAAPVIMMTWFYAFFYSTVQRTSQKQRS RTLTFVSVLLISFVALQTPYVSLMIFNSYATTAWPMQCEHLTLRRTIGTLARVVPHLHCL INPILYALLGHDFLQRMRQCFRGQLLDRRAFLRSQQNQRATAETNLAAGNNSQSVATSLD TNSKNYNQHAKRSVSFNFPSGTWKGGQKTASNDTSTKIPHRLSQSHHNLSGV
Source in vitro E.coli expression system
Gene Names UL33
Protein Names Recommended name: G-protein coupled receptor homolog UL33 Short name= vGPCR UL33
Expression Region 1-412
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function G-protein-coupled receptor (vGPCR) that constitutively activates multiple signaling pathways in a ligand independent manner. For example, promotes phospholipase C and cAMP-responsive element (CRE) pathway activation. Therefore, greatly contributes to viral pathogenesis. Inhibits US28-mediated NF-kappa-B activation.
Subcellular Location Virion, Host cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family

Related Products

UL33 Proteins

UL33 Proteins for Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.