Recombinant Human cytomegalovirus Uncharacterized protein UL10(UL10)

Code CSB-CF324576HWV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P16843
Storage Buffer Tris-based buffer,50% glycerol
Species Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Sequence MRRLINHIVNHDLFRWSVMTAMIFYRYSETCMEVTVRVGDPVTLGSGHGYHPGQKVHWYN QSCVGISNGENTHPICTYDPPKPGRRKTMKTTPLPSPLLYECHNSTLSILHVNVSDPKNY CRRKCPPNGNCEFPTCFTLSLISRTTTTRKPGQKTTLSRLKTTPNKHTQHKRSTRRTSPR DYNVTGLPKGFADSFTGNVEAHRAKDAAHSAWILIVIIIIIVVILFFFKIPQRLREKWDT RGYLYKGTDGLPTTDYLS
Source in vitro E.coli expression system
Gene Names UL10
Protein Names Recommended name: Uncharacterized protein UL10
Expression Region 1-258
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Single-pass membrane protein
Protein Families RL11 family

Related Products

UL10 Proteins

UL10 Proteins for Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.