Recombinant Human herpesvirus 2 Ribonucleoside-diphosphate reductase small chain (UL40)

Code CSB-CF304000HJX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P69521
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Sequence MDPAVSPASTDPLDTHASGAGAAPIPVCPTPERYFYTSQCPDINHLRSLSILNRWLETEL VFVGDEEDVSKLSEGELGFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECI EVVHSRVYNIIQLVLFHNNDQARRAYVARTINHPAIRVKVDWLEARVRECDSIPEKFILM ILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPE AARVYRLFREAVDIEIGFIRSQAPTDSSILSPGALAAIENYVRFSADRLLGLIHMQPLYS APAPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL
Source in vitro E.coli expression system
Gene Names RIR2
Protein Names Recommended name: Ribonucleoside-diphosphate reductase small chain Short name= R2 EC= 1.17.4.1 Alternative name(s): Ribonucleotide reductase 38 kDa subunit Ribonucleotide reductase small subunit
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ribonucleoside-diphosphate reductase holoenzyme provides the precursors necessary for viral DNA synthesis. Allows virus growth in non-dividing cells, as well as reactivation from latency in infected hosts. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Subcellular Location Host membrane, Single-pass membrane protein
Protein Families Ribonucleoside diphosphate reductase small chain family
Database Links

KEGG: vg:1487327

Related Products

RIR2 Proteins

RIR2 Proteins for Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.