Recombinant Human herpesvirus 2 Ribonucleoside-diphosphate reductase small chain (UL40)

Code CSB-CF304000HJX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P69521
Storage Buffer Tris-based buffer,50% glycerol
Species Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
Sequence MDPAVSPASTDPLDTHASGAGAAPIPVCPTPERYFYTSQCPDINHLRSLSILNRWLETEL VFVGDEEDVSKLSEGELGFYRFLFAFLSAADDLVTENLGGLSGLFEQKDILHYYVEQECI EVVHSRVYNIIQLVLFHNNDQARRAYVARTINHPAIRVKVDWLEARVRECDSIPEKFILM ILIEGVFFAASFAAIAYLRTNNLLRVTCQSNDLISRDEAVHTTASCYIYNNYLGGHAKPE AARVYRLFREAVDIEIGFIRSQAPTDSSILSPGALAAIENYVRFSADRLLGLIHMQPLYS APAPDASFPLSLMSTDKHTNFFECRSTSYAGAVVNDL
Source in vitro E.coli expression system
Gene Names RIR2
Protein Names Recommended name: Ribonucleoside-diphosphate reductase small chain Short name= R2 EC= 1.17.4.1 Alternative name(s): Ribonucleotide reductase 38 kDa subunit Ribonucleotide reductase small subunit
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ribonucleoside-diphosphate reductase holoenzyme provides the precursors necessary for viral DNA synthesis. Allows virus growth in non-dividing cells, as well as reactivation from latency in infected hosts. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
Subcellular Location Host membrane, Single-pass membrane protein
Protein Families Ribonucleoside diphosphate reductase small chain family
Database Links

KEGG: vg:1487327

Related Products

RIR2 Proteins

RIR2 Proteins for Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.