Recombinant Human respiratory syncytial virus A Major surface glycoprotein G(G)

Code CSB-CF365937HPO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P03423
Storage Buffer Tris-based buffer,50% glycerol
Species Human respiratory syncytial virus A (strain A2)
Sequence HKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTL QSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAIC KRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITT LLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQ
Source in vitro E.coli expression system
Gene Names G
Protein Names Recommended name: Major surface glycoprotein GAlternative name(s): Attachment glycoprotein G Membrane-bound glycoprotein Short name= mG
Expression Region 67-298
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Interacts with host CX3CR1, the receptor for the CX3C chemokine fractalkine, to modulate the immune response and facilitate infection. Unlike the other paramyxovirus attachment proteins, lacks both neuraminidase and hemagglutinating activities.; FUNCTION
Subcellular Location Virion membrane, Host cell surface, SUBCELLULAR LOCATION: Isoform Secreted glycoprotein G: Secreted
Protein Families Pneumoviruses glycoprotein G family

Related Products

G Antibodies

G Antibodies for Human respiratory syncytial virus A (strain A2)

G Proteins

G Proteins for Human respiratory syncytial virus A (strain A2)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.