Recombinant Hydrogenase-4 component E(hyfE)

Code CSB-CF360176EOD
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0AEW2
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli O157:H7
Sequence MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG
Source in vitro E.coli expression system
Gene Names hyfE
Protein Names Recommended name: Hydrogenase-4 component E EC= 1.-.-.-
Expression Region 1-216
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Database Links

KEGG: ece:Z3745

STRING: 155864.Z3745

Related Products

hyfE Antibodies

hyfE Antibodies for Escherichia coli O157:H7

hyfE Proteins

hyfE Proteins for Escherichia coli O157:H7

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.