Recombinant Inner membrane protein YccA(yccA)

Code CSB-CF359437EGX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0AAC7
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Sequence MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMY GLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCC SAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFET SNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD
Source in vitro E.coli expression system
Gene Names yccA
Protein Names Recommended name: Inner membrane protein YccA
Expression Region 1-219
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families BI1 family
Database Links

KEGG: ecc:c1110

STRING: 199310.c1110

Related Products

yccA Antibodies

yccA Antibodies for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

yccA Proteins

yccA Proteins for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.