Recombinant Klebsiella pneumoniae Probable intracellular septation protein A (KPK_3196)

Code CSB-CF466640KBH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B5XT16
Storage Buffer Tris-based buffer,50% glycerol
Species Klebsiella pneumoniae (strain 342)
Sequence MKQFLDFLPLVVFFAFYKLYDIYAATTALIVATAIVLIYSWVRYRKVEKMALITFVLVAV FGGLTLFFHNDEFIKWKVTVIYALFAGALLFSQWVMKKPLIQRMLGKELALPQQVWSRLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLVFTLLSGIYIYRHMPQDDHH
Source in vitro E.coli expression system
Gene Names KPK_3196
Protein Names Recommended name: Probable intracellular septation protein A
Expression Region 1-179
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in cell division; probably involved in intracellular septation.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families YciB family
Database Links

KEGG: kpe:KPK_3196

Related Products

KPK_3196 Proteins

KPK_3196 Proteins for Klebsiella pneumoniae (strain 342)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.