Recombinant Lactobacillus plantarum Glycerol uptake facilitator protein 4(glpF4)

Code CSB-CF978635LMS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. F9UMX3
Species Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Sequence MIHQLLAEFMGTALMIIFGVGVHCSEVLKGTKYRGSGHIFAITTWGFGITIALFIFGNVCINPAMVLAQCILGNLSWSLFIPYSVAEVLGGVVGAVIVWIMYADHFAASADEISPITIRNLFSTAPAVRNLPRNFFVEFFDTFIFISGILAISEVKTPGIVPIGVGLLVWAIGMGLGGPTGFAMNLARDMGPRIAHAILPIKNKADSDWQYGIIVPGIAPFVGAACAALFMHGFFGIG
Source in vitro E.coli expression system
Gene Names glpF4
Expression Region 1-238
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transporter that facilitates the transmembrane diffusion of water, dihydroxyacetone, glycerol, urea, H(2)O(2) and D/L-lactic acid. Is involved in the cellular racemization of lactate and lactate metabolism, but has likely a more general physiological role. The transported molecule is indeed lactic acid and not the lactate anion, in agreement with the assumption that, with very few exceptions, MIPs (major intrinsic proteins) only facilitate the transport of uncharged solutes.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: lpl:lp_1175

STRING: 220668.lp_1175

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.