Recombinant Lactobacillus plantarum Glycerol uptake facilitator protein-like 5(glpF5)

Code CSB-CF279962LMS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. F9UUB3
Species Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Sequence MTGSWEARYAAEFFGTLILVLLGNGAVANAFLKNTTGNDDPGLANGGWLLVASGYGLGVMLPAMMFGSISGNHLNPAITIGQAVIGIFPWAHVAPYLIWQFLGAIAGQCLILALYWPHYRQTTDNEAVLGTFATSDHANSQLNGFVTEMVGTAVLIFGAMGLYRGMFFHQNIDIANIGVGLLIAAMVISLGGPTGPALNPARDLGPRLVHALFPVPNKGSSHWEYSWVPVVAPIVGAVIGIWIYKIFFGL
Source in vitro E.coli expression system
Gene Names glpF5
Expression Region 1-250
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable transporter that facilitates the transmembrane diffusion of an unknown substrate. Is not permeable to water, dihydroxyacetone, glycerol, urea, H(2)O(2) and D/L-lactic acid.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: lpl:lp_3436

STRING: 220668.lp_3436

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.