Recombinant Lactobacillus plantarum Glycerol uptake facilitator protein-like 6 (glpF6)

Code CSB-CF950889LMS
MSDS
Size $1626
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
glpF6
Uniprot No.
Alternative Names
glpF6; lp_3463Glycerol uptake facilitator protein-like 6
Species
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Source
in vitro E.coli expression system
Expression Region
1-216
Target Protein Sequence
MRKYLAEFLGTFMLVFLGTATVVIAKGDVLAIGLAFGLAITVSAYAFGGISGGHFNPAVTTAMLINRRIDAADAIGYIIAQIIGAIVASAAVKSFVSALGLSATLLGQTDFPKIGSGMAFFVEALVTFLFLMVILNVTSNDHGNADFAGLTIGVTLAFLIIVALNLTGGSLNPARSIGPAIFAGGSALSHLWVYILAPEVGAILAAFCARVMGSED
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable transporter that facilitates the transmembrane diffusion of an unknown substrate. Is not permeable to water, dihydroxyacetone, glycerol, urea, H(2)O(2) and D/L-lactic acid.
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Database Links

KEGG: lpl:lp_3463

STRING: 220668.lp_3463

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*