Recombinant Lipopolysaccharide export system permease protein lptG(lptG)

Code CSB-CF359925EGX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P0ADC7
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Sequence MQPFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDALGAGMYTLLSV PKDVQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAI GEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYIERVKGDEELGGISIYAF NENRRLQSVRYAATAKFDPEHKVWRLSQVDESDLTNPKQITGSQTVSGTWKTNLTPDKLG VVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPL RSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIIGALLPSASFFLISLWLLMRKS
Source in vitro E.coli expression system
Gene Names lptG
Protein Names Recommended name: Lipopolysaccharide export system permease protein lptG
Expression Region 1-360
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the ABC transporter complex LptBFG involved in the translocation of lipopolysaccharide (LPS) from the inner membrane to the outer membrane.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families LptF/LptG family
Database Links

KEGG: ecc:c5363

STRING: 199310.c5363

Related Products

lptG Antibodies

lptG Antibodies for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

lptG Proteins

lptG Proteins for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.