Recombinant Lithobates pipiens Lens fiber major intrinsic protein

Code CSB-CF281361RJN
Size $626 How to order?
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Uniprot No. Q06019
Alternative Names Lens fiber major intrinsic protein; MIP26; MP26
Species Lithobates pipiens (Northern leopard frog) (Rana pipiens)
Source in vitro E.coli expression system
Expression Region 1-263
Target Protein Sequence MWEFRSFSFWRAVFAEFFGTMFYVFFGLGASLKWAAGPANVLVIALAFGLVLATMVQSIGHVSGAHINPAVTFAFLIGSQMSLFRAIFYIAAQLLGAVAGAAVLYGVTPAAIRGNLALNTLHPGVSLGQATTVEIFLTLQFVLCIFATYDERRNGRLGSVSLAIGFSLTLGHLFGLYYTGASMNPARSFAPAVLTRNFTNHWVYWVGPIIGGALGGLVYDFILFPRMRGLSERLSILKGARPAEPEGQQEATGEPIELKTQSL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length Full Length
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Water channel. May be responsible for regulating the osmolarity of the lens. Interactions between homotetramers from adjoining membranes may stabilize cell junctions in the eye lens core.
Subcellular Location Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families MIP/aquaporin (TC 1.A.8) family
Tissue Specificity Major component of lens fiber gap junctions.
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1