Recombinant Macaca mulatta Gonadotropin-releasing hormone II receptor(GNRHR2)

Code CSB-CF856800MOW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q95JG1
Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Sequence MSAGNGTPWGSAAGEESWAASGVAVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW SVTRPQPSQLRPSPVRTLFAHLAAADLLVTFVVMPLDATWNITVQWLAEDIACRTLMFLK LMAMYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHRA GPVPFTQCVTKGSFKARWQETTYNLFTFRCLFLLPLTAMAICYSHIVLSVSSPQTRKGSH APAGEFALCRSFDNCPRVRLWALRLALLILLTFILCWTPYYLLGLWYWFSPTMLTEVPPS LSHILFLFGLLNAPLDPLLYGAFTLGCQRGHQELSIDSSNEGSGRMLQQEIHALRQQEVQ KTVTSRSAGETKDISITSI
Source in vitro E.coli expression system
Gene Names GNRHR2
Protein Names Recommended name: Gonadotropin-releasing hormone II receptor Short name= GnRH II receptor Short name= GnRH-II-R Alternative name(s): Type II GnRH receptor
Expression Region 1-379
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: mcc:574163

STRING: 9544.ENSMMUP00000021109

UniGene: Mmu.3569

Related Products

GNRHR2 Proteins

GNRHR2 Proteins for Macaca mulatta (Rhesus macaque)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.