Recombinant Macaca mulatta (Rhesus macaque) N-formyl peptide receptor 3(FPR3)

Code CSB-CF008856MOW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P79191
Storage Buffer Tris-based buffer,50% glycerol
Species Macaca mulatta (Rhesus macaque)
Sequence METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFIFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFHMVSVAMREKWPFGTFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMTGLWILTIVLTLPNFIFWTTISTTNGDTYCIFNY PFWGDTVVERMNVFITMAKVSLILHFIIGFSIPMSIITVCYGIIVAKIHKKRMTKSSRPL HIFTAVVASFFICWFPYELTGILMAVWLKEILLNGKYKIILVLINPTSSLAFFNSCLNPS LYVFMGHNFQERLIRSLPTSLERALTEVPDSAQTSNTHTTSASPPEETE
Source in vitro E.coli expression system
Gene Names FPR3
Protein Names Recommended name: N-formyl peptide receptor 3 Alternative name(s): FMLP-related receptor II Short name= FMLP-R-II Formyl peptide receptor-like 2
Expression Region 1-349
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family

Related Products

FPR3 Proteins

FPR3 Proteins for Macaca mulatta (Rhesus macaque)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.