Recombinant Meleagris gallopavo P2Y purinoceptor 1(P2RY1)

Code CSB-CF017326MQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P49652
Storage Buffer Tris-based buffer,50% glycerol
Species Meleagris gallopavo (Wild turkey)
Sequence MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT SL
Source in vitro E.coli expression system
Gene Names P2RY1
Protein Names Recommended name: P2Y purinoceptor 1 Short name= P2Y1 Alternative name(s): 6H1 orphan receptor ATP receptor Purinergic receptor
Expression Region 1-362
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for extracellular adenine nucleotides such as ATP and ADP. Seems to mediate its action via a pertussis toxin insensitive G-protein, probably belonging to the G(q) family that activate a phosphatidylinositol-calcium second messenger system.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Mainly found in blood, brain, and lung. To a lesser extent in stomach, gut and skeletal muscle.
Database Links

KEGG: mgp:100303708

STRING: 9103.ENSMGAP00000017025

UniGene: Mga.4456

Pathway Rap1 signaling pathway

Related Products

P2RY1 Proteins

P2RY1 Proteins for Meleagris gallopavo (Wild turkey)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.