Recombinant Meleagris gallopavo Vasoactive intestinal polypeptide receptor(VIPR1)

Code CSB-CF841943MQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q91085
Storage Buffer Tris-based buffer,50% glycerol
Species Meleagris gallopavo (Wild turkey)
Sequence GLVVEVEVWWWRWRFGGGGCIMLEIEEERSQCPAEITEDNQTSGCRRQWDNITCWPEAQV GAVVVKPCPKYFRLLTTFLGNVSRNCTSQGWTDVYPAPYAVACGYDSTAHQGKEQTAFYG TVKTGYTIGHTLSLIALTAAMIILCLFRKLHCTRNYIHMHLFMSFIMRAIAVFIKDVTLF ESGEPEHCFVSSVGCKAMMVFFQYCVMANFFWLLVEGLYLHTLLVISFFSERKYFWWYIL IGWGAPSVFITAWTVVRIYFFNVGCWEEIIESPIWWIIKTPILVSILVNFILFICIIRIL VQKLHSPDVGHNETSQYSRLAKSTLLLIPLFGIHYIMFAFFPDNFKAQVKLVFELVVGSF QGFVVAVLYCFLNGEVQAELKRKWRRWHLERFLGSDMKYHHPSLGSNGTNFSTQISMLTK CSPKTRRCSSFQAEFSLV
Source in vitro E.coli expression system
Gene Names VIPR1
Protein Names Recommended name: Vasoactive intestinal polypeptide receptor Short name= VIP receptor Short name= VIP-R
Expression Region 20-457
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 2 family
Tissue Specificity Expressed in pituitary, hypothalamus, small intestine and ovarian follicles.
Database Links

KEGG: mgp:100303683

UniGene: Mga.4437

Related Products

VIPR1 Proteins

VIPR1 Proteins for Meleagris gallopavo (Wild turkey)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.