Recombinant Microcin-J25 export ATP-binding/permease protein McjD(mcjD)

Code CSB-CF895832ENL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9X2W0
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli
Sequence MERKQKNSLFNYIYSLMDVRGKFLFFSMLFITSLSSIIISISPLILAKITDLLSGSLSNF SYEYLVLLACLYMFCVISNKASVFLFMILQSSLRINMQKKMSLKYLRELYNENITNLSKN NAGYTTQSLNQASNDIYILVRNVSQNILSPVIQLISTIVVVLSTKDWFSAGVFFLYILVF VIFNTRLTGSLASLRKHSMDITLNSYSLLSDTVDNMIAAKKNNALRLISERYEDALTQEN NAQKKYWLLSSKVLLLNSLLAVILFGSVFIYNILGVLNGVVSIGHFIMITSYIILLSTPV ENIGALLSEIRQSMSSLAGFIQRHAENKATSPSIPFLNMERKLNLSIRELSFSYSDDKKI LNSVSLDLFTGKMYSLTGPSGSGKSTLVKIISGYYKNYFGDIYLNDISLRNISDEDLNDA IYYLTQDDYIFMDTLRFNLRLANYDASENEIFKVLKLANLSVVNNEPVSLDTHLINRGNN YSGGQKQRISLARLFLRKPAIIIIDEATSALDYINESEILSSIRTHFPDALIINISHRIN LLECSDCVYVLNEGNIVASGHFRDLMVSNEYISGLASVTE
Source in vitro E.coli expression system
Gene Names mcjD
Protein Names Recommended name: Microcin-J25 export ATP-binding/permease protein McjD Alternative name(s): Microcin-J25 immunity protein Microcin-J25 secretion ATP-binding protein McjD
Expression Region 1-580
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Is able to protect a cell, which harbors the plasmid pTUC100 encoding microcin J25, against microcin J25. Is required for microcin J25 export out of the producing cells.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily

Related Products

mcjD Antibodies

mcjD Antibodies for Escherichia coli

mcjD Proteins

mcjD Proteins for Escherichia coli

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.