Recombinant Milnesium tardigradum Aquaporin-2(AQP2)

Code CSB-CF260636ZBP
Product Type Transmembrane Protein
Size $674
Uniprot No. G5CTF9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Milnesium tardigradum (Water bear) (Tardigrade)
Sequence MCISEGKMDWRSWLRKKFQVRSQLLRGCMAEFLAVFVLMVFTEGCSASAIFTHRRNDLLFAAFGSGLAVTMAVYVAGGVTGAFLNPAIAVAFSVLGKLPWKNCFCYMIAQYLGAFLASLAIYAQYYDALNIFDGGHRQVLGDNGTAQIWSTYPQAFLSPQGAFVDQVFGTALLIIVVLSMVDKKNWKPQNGYFPIAIGLLIVVLDISLAYNAGAALNPSRDLAPRLFTYVAGYGTETFSVKGYTWFFVPVVGSHAGAIVGAVIYQLFIGAQWPQDDLDDSNSVSSMSIHEKNFSLAKRKNTRNFNLDITRDFKERNGISTVLY
Source in vitro E.coli expression system
Gene Names AQP2
Expression Region 1-323
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Aquaglyceroporin that may modulate the water content and osmolytes during anhydrobiosis
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.