Recombinant Milnesium tardigradum Aquaporin-8(AQP8)

Code CSB-CF547161ZBP
Product Type Transmembrane Protein
Size $689
Uniprot No. G5CTG5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Milnesium tardigradum (Water bear) (Tardigrade)
Sequence MSTAESRNHYKEVPTIEHYSEAIGITNRKKMDWRGWLRKSTLVRSQLIRGCMAEFLAVFVLMVFIEGSAATAIFTNRRQDILFGSISSGLGVAMAVYVAGGVSGAFLNPAVALAFAVLGKLSWKNCIFYMISQYLAAFVASCTMFAYLYEALNNFDGGERQMFGPNGTAHIWSTYPQPFLSPHTAFADQVFCTAILLIVVLAMCDSKNWKPHNGFLPIAIGLLIITISCTLSYNAGAAMNPSRDLAPRFFSYLAGYGTEPFGVKGYTWFFVPVLGSHCGAIIGGAIYQLFIGGQWPDDTSDTNSVSSMSYNEDNSTLTKRKQVSNIVHDSKGAKGSSTAPVN
Source in vitro E.coli expression system
Gene Names AQP8
Expression Region 1-342
Protein Description Full Length
Still Have Questions? Leave a Message or Start an on-line Chat
Function Aquaglyceroporin that may modulate the water content and osmolytes during anhydrobiosis
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MIP/aquaporin (TC 1.A.8) family

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.