Recombinant Mitochondrial import inner membrane translocase subunit TIM14(dnj-21)

Code CSB-CF007026CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P91454
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis elegans
Sequence MTGGLIVAGLGLAAVGFGARYVLRNQALIKKGMEAIPVAGGAFSNYYRGGFDQKMSRAEAAKILGVAPSAKPAKIKEAHKKVMIVNHPDRGGSPYLAAKINEAKDLMESSKS
Source in vitro E.coli expression system
Gene Names dnj-21
Protein Names Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): DnaJ homolog subfamily C member 21
Expression Region 1-112
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).
Subcellular Location Mitochondrion inner membrane, Single-pass membrane protein
Protein Families TIM14 family
Database Links

KEGG: cel:CELE_T19B4.4

STRING: 6239.T19B4.4

UniGene: Cel.16739

Related Products

dnj-21 Antibodies

dnj-21 Antibodies for Caenorhabditis elegans

dnj-21 Proteins

dnj-21 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.