Recombinant Mitochondrial import inner membrane translocase subunit TIM14(dnj-21)

Code CSB-CF007026CXY
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P91454
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis elegans
Sequence MTGGLIVAGLGLAAVGFGARYVLRNQALIKKGMEAIPVAGGAFSNYYRGGFDQKMSRAEAAKILGVAPSAKPAKIKEAHKKVMIVNHPDRGGSPYLAAKINEAKDLMESSKS
Source in vitro E.coli expression system
Gene Names dnj-21
Protein Names Recommended name: Mitochondrial import inner membrane translocase subunit TIM14 Alternative name(s): DnaJ homolog subfamily C member 21
Expression Region 1-112
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).
Subcellular Location Mitochondrion inner membrane, Single-pass membrane protein
Protein Families TIM14 family
Database Links

KEGG: cel:CELE_T19B4.4

STRING: 6239.T19B4.4

UniGene: Cel.16739

Related Products

dnj-21 Antibodies

dnj-21 Antibodies for Caenorhabditis elegans

dnj-21 Proteins

dnj-21 Proteins for Caenorhabditis elegans

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.