Recombinant Mouse 5-hydroxytryptamine receptor 2A (Htr2a)

Code CSB-CF010887MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Htr2a; Htr2; 5-hydroxytryptamine receptor 2A; 5-HT-2; 5-HT-2A; Serotonin receptor 2A
Species
Mus musculus (Mouse)
Expression Region
1-471
Target Protein Sequence
MEILCEDNISLSSIPNSLMQLGDDSRLYPNDFNSRDANTSEASNWTIDAENRTNLSCEGY LPPTCLSILHLQEKNWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VAFFIPLTIMVITYFLTIKSLQKEATLCVSDLSTRAKLSSFSFLPQSSLSSEKLFQRSIH REPGSYAGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGA LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENRKPLQLILVNTIPTLAYK SSQLQVGQKKNSQEDAEPTANDCSMVTLGNQHSEEMCTDNIETVNEKVSCV
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.
Gene References into Functions
  1. A pre- and post-synaptic distribution of 5-HT2aRs was found in hippocampus, related to facilitation of object memory. PMID: 27114257
  2. these data demonstrate that sustained SERT loss of function reduces 5-HT2AR surface expression that is critical for the synergistic activation of alphaIIbbeta3 by 5-HT and ADP. PMID: 27422820
  3. heterodimerization with 5-HT2C receptors does not alter 5-HT2C Galphaq-dependent inositol phosphate signaling, 5-HT2A or 5-HT2B receptor-mediated signaling was totally blunted. This feature can be explained by a dominance of 5-HT2C on 5-HT2A and 5-HT2B receptor binding; in 5-HT2C-containing heterodimers, ligands bind and activate the 5-HT2C protomer exclusively. PMID: 28258217
  4. In the present study we have demonstrated four new principal facts concerning the role of 5-HT2A receptors in thermoregulation PMID: 26621247
  5. Allosteric signaling through an mGlu2 and 5-HT2A heteromeric receptor complex and its potential contribution to schizophrenia. PMID: 26758213
  6. Data indicate a role of presynaptic 5-hydroxytryptamine (serotonin) receptor 2A (5-HT2A receptor) located at thalamocortical synapses in the control of thalamofrontal connectivity and the associated cognitive functions. PMID: 26903620
  7. Whole-brain mapping and pharmacological screening indicated that serotonin-2A receptor (Htr2a)-expressing cells in the central amygdala (CeA) control both innate and learned freezing, but in opposing directions PMID: 26590419
  8. Hippocampal mRNA expression of Htr2a is decreased in serotonin deficient mice after early life stress. PMID: 25602134
  9. Involvement of 5-HT2 receptors in the expression of withdrawal diarrhea in morphine-dependent mice PMID: 25034809
  10. Elevated whole-blood 5HT or hyperserotonemia is a consistent finding in approximately 30% of autistic spectrum disorder individuals. PMID: 24894823
  11. Translational and ecological study involving constitutive Htr2a(-/-) knock-out mice and related SNPs in depressed patients suggests that a lower neurotransmission at the 5-HT2AR may favor the susceptibility and severity of major depressive disorder PMID: 24801750
  12. The results highlight a likely role of the 5-HT2 receptors in allergic airways disease and suggest that 5-HT2 receptor agonists may represent an effective and novel small molecule-based therapy for asthma. PMID: 25416380
  13. Results of the current study suggest aggression displayed by TLX null and heterozygous mice involves 5-HT(2A/C) receptors. PMID: 23933143
  14. the serotonin transporter has a role in regulating clearance of apoptotic cells through neuroendocrine signaling PMID: 24570000
  15. Blockade of 5-HT2A receptors strengthens antidepressant effects of escitalopram by enhancing norepinephrine transmission. PMID: 23411676
  16. These studies provide additional support for the link between 5-HT2A activation and hallucinogenesis. PMID: 23376711
  17. The cortical population of 5-HT2A receptors mediate the locomotor-suppressing effects of clozapine. PMID: 22871913
  18. 5-HT(2A) receptor-dependent signaling epigenetically affects mGlu2 transcription in mouse frontal cortex. PMID: 23508685
  19. Augmented contractile properties of arteries in a model of type 2 diabetes mellitus are not due to changes in 5HT(2A)/5HT(2B) receptors. PMID: 23346101
  20. Central administration of brain-derived neurotrophic factor leads to increase of 5-HT1A receptor gene expression but not 5-HT1A functional activity in mice genetically predisposed to beehavioral disorders. PMID: 22531372
  21. Three residues located at the intracellular end of transmembrane domain four are necessary for the mGlu2 receptor binding to 5TR2A. PMID: 23129762
  22. Data suggest that stimulation of 5HT2AR facilitates consolidation/extinction of fear memory and consolidation of object memory; blocking 5HT2AR impairs acquisition of fear memory extinction. Studies assume hippocampal/amygdala sites of action. PMID: 22722027
  23. These findings provide a mechanism to explain the reduced sensitivity of Egr3(-/-) mice to the locomotor suppressive effects of second generation anti-psychotics. PMID: 22692564
  24. Results suggested that 5-HT regulates epithelial proliferation and turnover. This regulation depended on neuronal rather than mucosal 5-HT. Serotonergic effects were linked to activation of 5-HT2A receptors on cholinergic submucosal neurons. PMID: 22609381
  25. The results of the present study suggest that the 5-HT2Ar could participate in the hippocampal neurotransmission by acting on different neuronal populations. PMID: 22119732
  26. Data suggest that Htr2a, serotonin, and signal transduction are important in mammary gland for induction of bone-regulating factors such as parathyroid hormone-related protein; results may apply in lactation and breast neoplasms. PMID: 22318950
  27. The results of this study suggest a significant role of 5-HT(2A)R and 5-HT(2B)R in respiratory network modulation. PMID: 21789169
  28. results indicate that 5-HT2ARs are crucial for MDMA-induced reinforcement and cue-induced reinstatement of MDMA-seeking behaviour. PMID: 20942998
  29. The 5-HT2AR-metabotropic glutamate mGluR2 receptor (mGluR2) complex is necessary for the neuropsychological responses induced by hallucinogens. PMID: 21276828
  30. Mice had high cortical 5-HT2A, but low 5-HT2C receptor densities. PMID: 21340474
  31. Both 5-HT(2A) and 5-HT(2C) receptors modulate cortical dopamine efflux, but in opposite directions. PMID: 21118683
  32. In frontal cortex of mice born to influenza virus-infected mothers, the 5-HT(2A) receptor is upregulated and the mGlu(2) receptor is downregulated, an alteration that may be involved in the behavioral changes observed. PMID: 21289196
  33. Altered serotonin transporter and/or 5-HT1A receptor functionality in hippocampus could contribute to the relatively low sociability of the BTBR mouse strain. PMID: 21070242
  34. Decreased 5-HT2A gene expression and 5-HT2A receptor functional activity was found in three investigated catalepsy prone mouse strains in comparison to catalepsy resistant AKR mice. PMID: 20345894
  35. A bifurcation of the 5-HT2A receptor signaling pathway is neurotransmitter- and beta-arrestin2-dependent. PMID: 20926677
  36. These observations point towards a direct association between amyloid-beta accumulation and changes in 5-HT2A receptor expression that is independent of upstream changes in the serotonergic system PMID: 20413853
  37. 5-HT(2A) receptor may be functionally expressed to regulate mechanisms underlying osteoblast cell proliferation, at least in part, through activation of ERK/MAPK pathways in MC3T3-E1 cells. PMID: 20399747
  38. We conclude that serotonergic connectivity was reproduced in vitro and that the serotonin neurite density is inhibited by chronic activation of the 5-HT(2) receptor. PMID: 19728996
  39. activation involving disruption of a strong ionic interaction between helices 3 and 6 PMID: 11801601
  40. was found on circular and longitudinal smooth muscle cells, neurons, enterocytes, and Paneth cells. PMID: 11960784
  41. findings suggest that 5-HT2A/5-HT2C serotonin receptors may be involved in the neural control of male sexual motivation and arousal PMID: 12097814
  42. Endogenous activation of serotonin-2A receptors is required for respiratory rhythm generation in brainstem slices. PMID: 12486201
  43. Knockout of serotonin transporter alters expression of 5-HT2A and 5-HT2C receptors in various brain regions; possible relation to altered knockout mouse behavior PMID: 12614326
  44. intracellular trafficking of 5-HT2A receptors is regulated by PSD-95 PMID: 12682061
  45. 5-HT(2A) receptors are strongly reduced in the frontal cortex, in the hippocampus, in the striatum and in the accumbens nucleus in socially isolated animals compared to group housed control mice. PMID: 12867255
  46. The 5-HT2A receptor expressed in NIH3T3 cells can couple to PLA2 activation though a complex signaling mechanism involving both Galphai/o-associated Gbetagamma-mediated ERK1,2 activation and Galpha12/13-coupled, Rho-mediated p38 activation PMID: 12887695
  47. The interaction of the 5-HT(2A) and the 5-HT(2C) receptor with specific sets of PDZ proteins may contribute to their different signal transduction properties PMID: 14988405
  48. findings indicate a specific role for cortical 5HT2AR function in the modulation of conflict anxiety, consistent with models of cortical, "top-down" influences on risk assessment PMID: 16873667
  49. These results suggest that obesity increases hypothalamic 5-HT2A receptor gene expression, and pharmacologic inactivation of 5-HT2A receptors inhibits overfeeding and obesity in A(y) mice, but did not increase plasma adiponectin levels. PMID: 17097612
  50. Interaction between 5-HT2 receptor activity in the dorsomedial medulla and CO(2) drive may elicit a cycle of hyperventilation with airway dilation and hypoventilation with airway narrowing PMID: 17537836

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, axon. Cytoplasmic vesicle. Membrane, caveola. Cell junction, synapse, presynapse.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in neurons in brain cortex. Detected in adult intestine, especially in mucosal epithelium, longitudinal and circular layers of muscularis externa and myenteric plexuses. Highly expressed in Paneth cells, and detected at lower levels in enterocyte
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1