Recombinant Mouse 5-hydroxytryptamine receptor 7 (Htr7)

Code CSB-CF010899MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Htr7
Uniprot No.
Alternative Names
Htr7; 5-hydroxytryptamine receptor 7; 5-HT-7; 5-HT7; 5-HT-X; Serotonin receptor 7
Species
Mus musculus (Mouse)
Expression Region
1-448
Target Protein Sequence
MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPA PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQK EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE ALKLAERPERSEFVLQNCDHCGKKGHDT
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Gene References into Functions
  1. Downregulation of the 5-HT7 receptor in the medial prefrontal cortex (mPFC) improves neonatal administration of phencyclidine-induced attentional deficits and impulsive-like overresponding and exacerbates compulsivity. These results suggest that 5-HT7R is involved in the cognitive outcomes of schizophrenia-like symptoms similar to humans. PMID: 29278697
  2. The present study demonstrated that acute heroin administration resulted in robust disruptions in attention, impulsivity and motivation in mice. PMID: 29155092
  3. The underlying molecular machinery involves 5-HT7R-mediated activation of MMP-9, which leads to CD44 cleavage followed by Cdc42 activation. PMID: 28564597
  4. The results of this study provide evidence for the essential role of the 5HT7R in the acquisition of an allocentric strategy and in the ability to learn concomitantly both strategies. PMID: 27939340
  5. The data of this study suggest that the 5-HT7R-mediated structural reorganization during the postnatal development might have a crucial role for the development and plasticity of forebrain areas such as cortex and striatum. PMID: 28122114
  6. this study shows that 5-HT7 is expressed in the liver in vivo and in vitro in CCl4-induced damage, and that 5-HT7 receptor agonist but not the antagonist shows hepatoprotective effect against liver fibrosis PMID: 28043031
  7. 5-HT7 is required for multiple actions of serotonin in the mammary glands. PMID: 25664318
  8. Activation of HTR7 promoted opening of the ion channel TRPA1, which in turn triggered itch behaviors. Acute itch triggered by serotonin or a selective serotonin reuptake inhibitor required both HTR7 and TRPA1, as did development of atopic dermatitis. PMID: 26074006
  9. Blockade of 5-HT7R Results in Increased Severity of Chronic DSS-induced Colitis. PMID: 25072499
  10. data suggest that 5-HT7R tonically modulates cognitive processes involved in consolidation performances in object recognition. PMID: 23995300
  11. These results indicate that 5-HT receptors are functionally expressed in a subpopulation of substantia gelatinosa neurons of the and activation of 5-HT receptors plays an important role in modulating orofacial nociceptive processing. PMID: 24516875
  12. The results provide evidence that lurasidone can act as a 5-HT7 receptor antagonist and provide a possible explanation for its antidepressant effect. PMID: 23416039
  13. Colitis severity was significantly lower in 5-HT7(-/-) mice. PMID: 23554310
  14. 5-HT7 receptor functionally involved in the development of stress adaptation.[review] PMID: 23012886
  15. Activation of the serotonin 5-HT7 receptor promotes synaptogenesis and enhances synaptic activity in hippocampal neurons at early postnatal stages. PMID: 22378867
  16. 5-HT-induced hypothermia is mediated by the 5-HT(7) receptor PMID: 12529502
  17. Binding sites consistent with mRNA distribution with highest densities found in anterior thalamic nuclei. PMID: 15026130
  18. The results indicate an important role for the 5-HT(7) receptor in contextual hippocampal-dependent learning and suggest a possible neuronal correlate for such a role is present within the CA1 region of the hippocampus. PMID: 15078565
  19. Data demonstrate distinct roles for 5-HT7R/G12 signaling pathways in neurite outgrowth and retraction PMID: 16120784
  20. The results, with selective antagonists and knockout animals, provide compelling evidence of a specific contribution of 5-HT7 receptors to spinal locomotor rhythmogenesis in vivo. PMID: 16836640
  21. The 5-HT7 receptor is of importance for behaviors affected by antidepressants; this suggests that the 5-HT7 receptor might be of relevance as a target for the treatment of obsessive-compulsive disorder. PMID: 17267119
  22. Cloning, genomic organization and functionality of 5-HT7 receptor splice variants from mouse brain are reported. PMID: 18793707
  23. 5-HT(7) receptor deletion augments the effect of various SSRIs on REM sleep suppression and this effect is distinct from those mediated via 5-HT(1A) receptors. PMID: 18948124
  24. present study has shown that the 5-HT7 receptor is of importance for allocentric spatial memory PMID: 19447277
  25. These results suggest that spinal 5-HT7 receptors are required for the production and coordination of 5-HT-induced locomotor-like activity in the neonatal mouse and are important for the coordination of voluntary locomotion in adult mice. PMID: 19458153

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1